Sequence 1: | NP_477451.1 | Gene: | Pfrx / 32938 | FlyBaseID: | FBgn0027621 | Length: | 716 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_508832.2 | Gene: | T07F12.1 / 188238 | WormBaseID: | WBGene00020321 | Length: | 283 | Species: | Caenorhabditis elegans |
Alignment Length: | 220 | Identity: | 42/220 - (19%) |
---|---|---|---|
Similarity: | 73/220 - (33%) | Gaps: | 60/220 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 466 RTIYLTRHGES---EYNLSGL-------------------------------IGGDSNLSARGHQ 496
Fly 497 YANALSTFIAQQQIDGLRVWTSWMKRAIQTVADVKAPQERWKALN-EIDAGHCEEMTYEQIKEKF 560
Fly 561 PEEFKARDVNKFAYRYPRGESY----EDLVARLEPVIMELER--------------QGNVLVVSH 607
Fly 608 QAVLRCLFAYFLD---KSADELPYL 629 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Pfrx | NP_477451.1 | 6PF2K | 254..465 | CDD:279872 | |
AAA_33 | 256..412 | CDD:290396 | |||
His_Phos_1 | 468..651 | CDD:278716 | 41/218 (19%) | ||
T07F12.1 | NP_508832.2 | HP_PGM_like | 5..216 | CDD:132718 | 39/214 (18%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0406 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |