Sequence 1: | NP_477451.1 | Gene: | Pfrx / 32938 | FlyBaseID: | FBgn0027621 | Length: | 716 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492409.2 | Gene: | F53B6.7 / 172710 | WormBaseID: | WBGene00009962 | Length: | 316 | Species: | Caenorhabditis elegans |
Alignment Length: | 244 | Identity: | 49/244 - (20%) |
---|---|---|---|
Similarity: | 90/244 - (36%) | Gaps: | 59/244 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 407 FLQRIEHYEERYQPIDEVTESHLSFMKVYNAGKKVVVYNNEGHVESRIVYYLMNIHITPRTIYLT 471
Fly 472 RHGESEYNLSGLIGGDSNLSARGHQYANALSTFIAQQQIDGLRVWTSWMKRAIQTVAD-VKAPQE 535
Fly 536 RWKALNEIDAGHCEEMTYEQIKEKFPEEFKARDVNKFAY---RYP------------RGESYEDL 585
Fly 586 -----------VARLEP---------VIMELERQGNVLVVSHQAVLRCL 614 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Pfrx | NP_477451.1 | 6PF2K | 254..465 | CDD:279872 | 12/57 (21%) |
AAA_33 | 256..412 | CDD:290396 | 2/4 (50%) | ||
His_Phos_1 | 468..651 | CDD:278716 | 36/183 (20%) | ||
F53B6.7 | NP_492409.2 | PhoE | 105..>236 | CDD:223483 | 27/137 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0406 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |