DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfrx and pfkfb1

DIOPT Version :9

Sequence 1:NP_477451.1 Gene:Pfrx / 32938 FlyBaseID:FBgn0027621 Length:716 Species:Drosophila melanogaster
Sequence 2:XP_004919688.1 Gene:pfkfb1 / 100488795 XenbaseID:XB-GENE-957710 Length:525 Species:Xenopus tropicalis


Alignment Length:498 Identity:281/498 - (56%)
Similarity:342/498 - (68%) Gaps:46/498 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 MSEELRKL---------LPPTSETVMTKPFPIRGERTIADCTTPHVIAMVGLPARGKTFISKKLA 275
            |:|.||:|         :|...|.:..:    ||........:|.:|.||||||||||:|||||.
 Frog    28 MAEILRELKQTRLQKIWIPHQCERLQQR----RGSSIPQFTNSPTMIIMVGLPARGKTYISKKLT 88

  Fly   276 RYLNWIGISTRVFNLGEYRRHATTAYKSHEFFRADNEEAMAIRNRCANQALHDSCDWLLSGQGSI 340
            ||||||||.|:|||:|:|||.....||::|||..||:|||.||.:||..||.|...:|...:|.:
 Frog    89 RYLNWIGIPTKVFNVGQYRREVVQTYKNYEFFHPDNQEAMKIRKQCALSALRDVDKYLTQEEGQV 153

  Fly   341 AVFDATNSTRDRRQLIHDIVVKQHGFRLFFVESICDDPQIIEQNILEVKVSSPDYLNMNTELVVR 405
            |||||||:||:||.||... .|:..|:.||:|||||||.||.:||:|||:|||||.:.:.|.||.
 Frog   154 AVFDATNTTRERRSLILQF-AKERVFKAFFIESICDDPDIIAENIMEVKLSSPDYKDCDREKVVE 217

  Fly   406 DFLQRIEHYEERYQPIDEVTESHLSFMKVYNAGKKVVVYNNEGHVESRIVYYLMNIHITPRTIYL 470
            |||:|||.|...|||:.:..:|.||::|::|.|.:.:|...:.|::||.||||||||:|||:|||
 Frog   218 DFLKRIECYNMYYQPLHDDLDSSLSYIKIFNVGSRYLVNRVQDHIQSRAVYYLMNIHVTPRSIYL 282

  Fly   471 TRHGESEYNLSGLIGGDSNLSARGHQYANALSTFIAQQQIDGLRVWTSWMKRAIQTVADVKAPQE 535
            .||||||.||.|.|||||.||.||.|:|:||..|:..|||..|:||||.|||.|||...:..|.|
 Frog   283 CRHGESELNLLGRIGGDSGLSTRGKQFAHALGNFVKSQQITDLKVWTSHMKRTIQTAEALGVPYE 347

  Fly   536 RWKALNEIDAGHCEEMTYEQIKEKFPEEFKARDVNKFAYRYPRGESYEDLVARLEPVIMELERQG 600
            :||||||||||.|||||||:|:|:|||||..||.:|:.||||:||||||||.||||||||||||.
 Frog   348 QWKALNEIDAGVCEEMTYEEIQERFPEEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQE 412

  Fly   601 NVLVVSHQAVLRCLFAYFLDKS----------------------------ADELPYLYVPLHTVI 637
            |||||.||||:|||.|||||||                            |::||||..|||||:
 Frog   413 NVLVVCHQAVMRCLLAYFLDKSAGKQTRHCIICCRWTWVSLIFMIYSPPPAEQLPYLKCPLHTVL 477

  Fly   638 KLTPVAYGCKVEHIKLPIDAVDTHRPKPKIPGDVS---EPGLD 677
            ||||||||||||.|.|.|:||:|||.|| ...|||   |..||
 Frog   478 KLTPVAYGCKVESIYLNIEAVNTHREKP-FNVDVSRDPEEALD 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PfrxNP_477451.1 6PF2K 254..465 CDD:279872 119/210 (57%)
AAA_33 256..412 CDD:290396 94/155 (61%)
His_Phos_1 468..651 CDD:278716 134/210 (64%)
pfkfb1XP_004919688.1 6PF2K 58..277 CDD:334602 119/219 (54%)
His_Phos_1 280..434 CDD:366010 110/153 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 275 1.000 Domainoid score I1721
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 544 1.000 Inparanoid score I1139
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D232517at33208
OrthoFinder 1 1.000 - - FOG0000312
OrthoInspector 1 1.000 - - otm48632
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X325
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.