DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-18 and Ndufs4

DIOPT Version :9

Sequence 1:NP_573385.1 Gene:ND-18 / 32936 FlyBaseID:FBgn0031021 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001020317.1 Gene:Ndufs4 / 499529 RGDID:1594380 Length:175 Species:Rattus norvegicus


Alignment Length:189 Identity:83/189 - (43%)
Similarity:119/189 - (62%) Gaps:30/189 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ALRQVMCR----STASLQLYQANRAAAARWASTAT----DGGPLDPKTALARPEELEQRNKLSGK 59
            :|||.:.|    :||::.:.:    ..:|..:|:|    ||...|.:.                 
  Rat     9 SLRQALLRQRAVATAAVSVCR----VPSRLLNTSTWKLADGQTRDTQL----------------- 52

  Fly    60 ITVPTAVNLSPISGVPEEHIRERRVRIHIPPKNAMQSGTDNVNTWQIEFDNRERWENPLMGWASS 124
            |||...::::|::|||||||:.|:|||.:|.:|.||||.:|...|::|||.|||||||||||||:
  Rat    53 ITVDEKLDVTPLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWAST 117

  Fly   125 GDPLSNMNVQFGSPEEAITFCERNGWRWYVDGAAKPKKERVKNYGINFAWNKRTRVSTK 183
            .||||||.:.|.:.|:|:.|.|::||.:.|:|...| |.:.|:||.||:||||||||||
  Rat   118 ADPLSNMVLTFSAKEDAVAFAEKHGWSYDVEGRKVP-KPKSKSYGANFSWNKRTRVSTK 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-18NP_573385.1 ETC_C1_NDUFA4 83..178 CDD:398460 52/94 (55%)
Ndufs4NP_001020317.1 ETC_C1_NDUFA4 76..167 CDD:282634 49/91 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..175 15/23 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354080
Domainoid 1 1.000 123 1.000 Domainoid score I5485
eggNOG 1 0.900 - - E1_KOG3389
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4158
OMA 1 1.010 - - QHG60116
OrthoDB 1 1.010 - - D1507807at2759
OrthoFinder 1 1.000 - - FOG0006306
OrthoInspector 1 1.000 - - oto98922
orthoMCL 1 0.900 - - OOG6_103517
Panther 1 1.100 - - LDO PTHR12219
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4590
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.