DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-18 and lpd-5

DIOPT Version :9

Sequence 1:NP_573385.1 Gene:ND-18 / 32936 FlyBaseID:FBgn0031021 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001370829.1 Gene:lpd-5 / 172037 WormBaseID:WBGene00003061 Length:176 Species:Caenorhabditis elegans


Alignment Length:185 Identity:77/185 - (41%)
Similarity:106/185 - (57%) Gaps:18/185 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MCRSTASLQLYQANRAAAARWASTATDGGPLDPKTALARPEELEQRNKLSGKITVPTAVNLS--- 69
            |.|:.||..|...|  .|.|..||..|..|: .::..|:..||   |.:..|.:..|.|.:|   
 Worm     1 MLRAGASRCLSAGN--TAFRCLSTGKDNLPV-TRSHDAKKVEL---NDILDKPSQKTPVKVSSDE 59

  Fly    70 --PISGVPEEHIRERRVRIHIPPKNAMQSGTDNVNTWQIEFDNRERWENPLMGWASSGDPLSN-- 130
              .|.|||.:|...|..||..|.:...||...|..:|.||.|||:|||||||||:.:.|||||  
 Worm    60 TMDIGGVPLDHQDARTARIFRPARETTQSAWGNTKSWTIELDNRQRWENPLMGWSGTADPLSNVG 124

  Fly   131 MNVQFGSPEEAITFCERNGWRWYVDGAAKPKKERV--KNYGINFAWNKRTRVSTK 183
            |:::|.:.|:||.|||:|.|.:.|:   :|.:.::  ||||.||:||:|||:.||
 Worm   125 MDLKFATKEDAIAFCEKNRWEFDVE---EPHERKIKPKNYGQNFSWNRRTRIGTK 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-18NP_573385.1 ETC_C1_NDUFA4 83..178 CDD:398460 46/98 (47%)
lpd-5NP_001370829.1 ETC_C1_NDUFA4 75..171 CDD:398460 46/98 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167524
Domainoid 1 1.000 103 1.000 Domainoid score I4266
eggNOG 1 0.900 - - E1_KOG3389
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I3264
Isobase 1 0.950 - 0 Normalized mean entropy S3431
OMA 1 1.010 - - QHG60116
OrthoDB 1 1.010 - - D1507807at2759
OrthoFinder 1 1.000 - - FOG0006306
OrthoInspector 1 1.000 - - oto18566
orthoMCL 1 0.900 - - OOG6_103517
Panther 1 1.100 - - LDO PTHR12219
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4298
SonicParanoid 1 1.000 - - X4590
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.