DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-18 and ndufs4

DIOPT Version :9

Sequence 1:NP_573385.1 Gene:ND-18 / 32936 FlyBaseID:FBgn0031021 Length:183 Species:Drosophila melanogaster
Sequence 2:XP_002941075.1 Gene:ndufs4 / 100125122 XenbaseID:XB-GENE-947419 Length:169 Species:Xenopus tropicalis


Alignment Length:182 Identity:87/182 - (47%)
Similarity:114/182 - (62%) Gaps:21/182 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ALRQVMCRSTASLQLYQANRA-AAARWASTATDGGPLDPKTALARPEELEQRNKLSGKITVPTAV 66
            ||||::..|.....:..:||: :.:.|....|.          |:..:|         |||...:
 Frog     8 ALRQLLWGSRTVGAVINSNRSLSTSTWRLAQTQ----------AQDTQL---------ITVDEKM 53

  Fly    67 NLSPISGVPEEHIRERRVRIHIPPKNAMQSGTDNVNTWQIEFDNRERWENPLMGWASSGDPLSNM 131
            ::|.|||||||||:.|:|.|.:|.:||||||..|...|:||||.|||||||||||||:.||||||
 Frog    54 DISTISGVPEEHIKTRKVHIFVPARNAMQSGVQNTKRWKIEFDTRERWENPLMGWASTADPLSNM 118

  Fly   132 NVQFGSPEEAITFCERNGWRWYVDGAAKPKKERVKNYGINFAWNKRTRVSTK 183
            .:.|.|.|:||:|.|:|||.:.|:....| |.:.|:||.||:||||||||||
 Frog   119 LLSFSSKEDAISFAEKNGWSYEVEEKRIP-KPKSKSYGANFSWNKRTRVSTK 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-18NP_573385.1 ETC_C1_NDUFA4 83..178 CDD:398460 55/94 (59%)
ndufs4XP_002941075.1 ETC_C1_NDUFA4 70..164 CDD:368126 55/94 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 125 1.000 Domainoid score I5420
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I4108
OMA 1 1.010 - - QHG60116
OrthoDB 1 1.010 - - D1507807at2759
OrthoFinder 1 1.000 - - FOG0006306
OrthoInspector 1 1.000 - - oto105616
Panther 1 1.100 - - LDO PTHR12219
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4298
SonicParanoid 1 1.000 - - X4590
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.