DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32533 and rpsN

DIOPT Version :10

Sequence 1:NP_728244.1 Gene:CG32533 / 32933 FlyBaseID:FBgn0052533 Length:1139 Species:Drosophila melanogaster
Sequence 2:NP_417766.1 Gene:rpsN / 947801 ECOCYCID:EG10913 Length:101 Species:Escherichia coli


Alignment Length:90 Identity:20/90 - (22%)
Similarity:39/90 - (43%) Gaps:29/90 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 SKRSQRNRIDPAPFVQVLSLIDQQYPTSERGDVLIFVSGVNEIESVVEAVHEYATEQTHW-LVLP 406
            :|:|.:.|     .|:.::|.|:.:  ::|.::...:|.||            |:::..| .||.
E. coli     2 AKQSMKAR-----EVKRVALADKYF--AKRAELKAIISDVN------------ASDEDRWNAVLK 47

  Fly   407 LHSGQAIADQSKVFDYAPEGMR-KC 430
            |        |:...|.:|...| :|
E. coli    48 L--------QTLPRDSSPSRQRNRC 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32533NP_728244.1 HrpA 145..>619 CDD:441249 20/90 (22%)
OB_NTP_bind 792..897 CDD:400182
rpsNNP_417766.1 rpsN 1..101 CDD:181574 20/90 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.