DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32533 and RPS14

DIOPT Version :10

Sequence 1:NP_728244.1 Gene:CG32533 / 32933 FlyBaseID:FBgn0052533 Length:1139 Species:Drosophila melanogaster
Sequence 2:NP_850232.1 Gene:RPS14 / 818015 AraportID:AT2G34520 Length:164 Species:Arabidopsis thaliana


Alignment Length:171 Identity:35/171 - (20%)
Similarity:65/171 - (38%) Gaps:44/171 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SSRRRTQINLIEFSFLDHKAELVGLLQAKSRQVGRSLVENEADFWKFVGKYEAMMRSTGQPVLPP 77
            :|.||..:|:..:.    :..|.....:.|..:.||:|::..:    :|:.:|...:|......|
plant     2 ASLRRVLLNVTSYC----QRSLTQSSYSTSGMLSRSVVKHANN----LGQIQARHFTTTLMKSGP 58

  Fly    78 RLAEAE--LSSMQPYHRSKHLALRLDADELLQEA--RD-----QMQSQFRHILLVYLDFRQTEKF 133
            :.:..|  :......||.:.||.|.:....|.:|  :|     :|:.:.|:              
plant    59 KHSGTEQGVKRNSADHRRRLLAARFELRRKLYKAFCKDPDLPSEMRDKNRY-------------- 109

  Fly   134 QRIRKLRQTQRNLPIARFR---------KDLREALDTSRVV 165
                ||.:..||...||.|         :.:.|....||:|
plant   110 ----KLSKLPRNSAFARIRNRCVFTGRSRSVTELFRVSRIV 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32533NP_728244.1 HrpA 145..>619 CDD:441249 8/30 (27%)
OB_NTP_bind 792..897 CDD:400182
RPS14NP_850232.1 rpsN 73..164 CDD:469739 21/92 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.