DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32533 and Rps29

DIOPT Version :9

Sequence 1:NP_001285437.1 Gene:CG32533 / 32933 FlyBaseID:FBgn0052533 Length:1139 Species:Drosophila melanogaster
Sequence 2:NP_033119.1 Gene:Rps29 / 20090 MGIID:107681 Length:56 Species:Mus musculus


Alignment Length:40 Identity:11/40 - (27%)
Similarity:18/40 - (45%) Gaps:3/40 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 GYRSIACTQPRRLACVSLCKRVA---HELLDDYGSRVAFQ 223
            |::.:..:.||:....|...||.   |.|:..||..:..|
Mouse     2 GHQQLYWSHPRKFGQGSRSCRVCSNRHGLIRKYGLNMCRQ 41

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32533NP_001285437.1 DEXDc 155..327 CDD:214692 11/40 (28%)
DEXDc 163..298 CDD:238005 11/40 (28%)
Helicase_C 358..490 CDD:278689
HA2 560..640 CDD:214852
OB_NTP_bind <792..897 CDD:285018
Rps29NP_033119.1 PTZ00218 1..56 CDD:185518 11/40 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.