DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32533 and mrps-14

DIOPT Version :10

Sequence 1:NP_728244.1 Gene:CG32533 / 32933 FlyBaseID:FBgn0052533 Length:1139 Species:Drosophila melanogaster
Sequence 2:NP_496208.2 Gene:mrps-14 / 174588 WormBaseID:WBGene00011334 Length:199 Species:Caenorhabditis elegans


Alignment Length:89 Identity:25/89 - (28%)
Similarity:41/89 - (46%) Gaps:10/89 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   701 SAERATRHGELRQLKAMKRRQRFEQ---PRQR-KLLK-----QSAGRVAEDEEEQEEAQGDDMRD 756
            :.:|.|.....|||:.:|||::.::   .|.| |.:|     ..|.|....|:.|:..:.|..|.
 Worm    93 TGKRMTFWASWRQLRDVKRREQIQEVGADRMRLKAIKFNTILPQAIRDEAAEKMQKARKYDHPRL 157

  Fly   757 VDFRLRFDPRQLALLERSSRLDRH 780
            :....:|..||...: :..||.||
 Worm   158 ILNMCQFTGRQRGKI-KPYRLSRH 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32533NP_728244.1 HrpA 145..>619 CDD:441249
OB_NTP_bind 792..897 CDD:400182
mrps-14NP_496208.2 Ribosomal_S14 145..197 CDD:459734 10/37 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.