DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32533 and RpS29

DIOPT Version :10

Sequence 1:NP_728244.1 Gene:CG32533 / 32933 FlyBaseID:FBgn0052533 Length:1139 Species:Drosophila melanogaster
Sequence 2:XP_321509.4 Gene:RpS29 / 1281578 VectorBaseID:AGAMI1_009310 Length:56 Species:Anopheles gambiae


Alignment Length:52 Identity:10/52 - (19%)
Similarity:20/52 - (38%) Gaps:19/52 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 GYRSIACTQPRRL--------AC-----------VSLCKRVAHELLDDYGSR 219
            |:.::..:.||:.        ||           :::|::...|...|.|.|
Mosquito     2 GFANLWYSHPRKYGQGSRFCRACSNNHGMIRKYGLNICRQCFREYAKDIGFR 53

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32533NP_728244.1 HrpA 145..>619 CDD:441249 10/52 (19%)
OB_NTP_bind 792..897 CDD:400182
RpS29XP_321509.4 rpsN 5..56 CDD:469739 9/49 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.