DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek5 and SLITRK6

DIOPT Version :9

Sequence 1:NP_001245746.1 Gene:kek5 / 32930 FlyBaseID:FBgn0031016 Length:931 Species:Drosophila melanogaster
Sequence 2:NP_115605.2 Gene:SLITRK6 / 84189 HGNCID:23503 Length:841 Species:Homo sapiens


Alignment Length:890 Identity:171/890 - (19%)
Similarity:303/890 - (34%) Gaps:258/890 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SCGT-CHCQWNSGKKSADCKNKALTKIPQDMSNEMQV-------LDFAHNQIPELRREEFLLAGL 98
            ||.: |:|:...|....:|:.|.:     .|.:|:.|       |...:|.:..|...:|  :||
Human    30 SCDSLCNCEEKDGTMLINCEAKGI-----KMVSEISVPPSRPFQLSLLNNGLTMLHTNDF--SGL 87

  Fly    99 PNVHKIFLRNCTIQEVHREAFKGLHILIELDLSGNRIRELHPGTFAGLEKLRNVIINNNEIEVLP 163
            .|...|.|....|.::...||.||.:|.:|.::.|.:..|...||.|||.|..:..:||.|.|:.
Human    88 TNAISIHLGFNNIADIEIGAFNGLGLLKQLHINHNSLEILKEDTFHGLENLEFLQADNNFITVIE 152

  Fly   164 NHLFVNLSFLSRIEFRNNRLRQVQLHVFAGTMALSAISLEQNRLSHLHKETF-KDLQKLMHLSLQ 227
            ...|..|:.|..:...:|.:..:..::|. .:.|:.:.|..|:|..|....| :.:.:::.|.|:
Human   153 PSAFSKLNRLKVLILNDNAIESLPPNIFR-FVPLTHLDLRGNQLQTLPYVGFLEHIGRILDLQLE 216

  Fly   228 GNAWNCSCELQDFRDFAISKRLYTPPTD------CQEPPQLRGKLWSEVPSENFACRPRI----- 281
            .|.|.|:|:|...:.:..:    .||..      |..||..:|.:.|.:..|:....|.:     
Human   217 DNKWACNCDLLQLKTWLEN----MPPQSIIGDVVCNSPPFFKGSILSRLKKESICPTPPVYEEHE 277

  Fly   282 -------LGSVRSFIEANHDN-----ISLPCRIVG------SPRPNVTWVYNKRP---------- 318
                   |.:..|..::....     :.||.:..|      .|...:...|...|          
Human   278 DPSGSLHLAATSSINDSRMSTKTTSILKLPTKAPGLIPYITKPSTQLPGPYCPIPCNCKVLSPSG 342

  Fly   319 --LQQYDPRVRVLTSVEQMPEQPSQVLTSELRIVGVRASDKGAYTC-----VADNR-GGRAEAEF 375
              :...:..:..|:.:...|:.|.:::.:...|..:..||...|..     :.:|| ....|..|
Human   343 LLIHCQERNIESLSDLRPPPQNPRKLILAGNIIHSLMKSDLVEYFTLEMLHLGNNRIEVLEEGSF 407

  Fly   376 -------QLLVSGDYAGAVSASDGMGMG---------------AIGAPTIDPQTNMFLIICLIIT 418
                   :|.::|::  ....|.||.:|               .|...|.:|...:.:   |.:.
Human   408 MNLTRLQKLYLNGNH--LTKLSKGMFLGLHNLEYLYLEYNAIKEILPGTFNPMPKLKV---LYLN 467

  Fly   419 TLLLLLLVAVLTLFWYCRRIKTYQKDTTMMSGDGLISSKMDKTHNGSMLEGSVIMEMQKSLLNEV 483
            ..||.:|                  ...:.||..|....: ||:..:.|..|.|:: ...||.::
Human   468 NNLLQVL------------------PPHIFSGVPLTKVNL-KTNQFTHLPVSNILD-DLDLLTQI 512

  Fly   484 NPVEKPPRRTDIESVDGGDDVLEI--------KKTLLDDTVYVANHSRDEEAVSVAMSDTTTTPR 540
            :..:.|        .|...|::.:        |.|:.||.:                   .|:| 
Human   513 DLEDNP--------WDCSCDLVGLQQWIQKLSKNTVTDDIL-------------------CTSP- 549

  Fly   541 SRHTYVDDAYANSLPPDLLAFPARVPPTSPSMQSSQSNIPDQVIYGIRSPPSLTSPVYTHMTPHG 605
               .::|.....:|..::|. |..|  .:|||       |.|..|.:     :|:|..|..|...
Human   550 ---GHLDKKELKALNSEILC-PGLV--NNPSM-------PTQTSYLM-----VTTPATTTNTADT 596

  Fly   606 IYGTKTMTAPHN------------------GFMTLQHPKSRNLALIATTNSSRQHQHHHQLQQQQ 652
            |..:.|...|.:                  |.:.|...:.|...........|.:...| ||...
Human   597 ILRSLTDAVPLSVLILGLLIMFITIVFCAAGIVVLVLHRRRRYKKKQVDEQMRDNSPVH-LQYSM 660

  Fly   653 QHH---HHHQQQQQQQQQQQHPLATTSPFLPAPVVYSPATGVVMKQGYMTIPRKPRAPSWAPSTS 714
            ..|   ||..::......:||.::      |...||                   |:||:.|.  
Human   661 YGHKTTHHTTERPSASLYEQHMVS------PMVHVY-------------------RSPSFGPK-- 698

  Fly   715 GAAGHGSIQLSEFQSPTSPNPSETGTATTAELQAEPVYDNLGLRTTAGGNSTLNLTKIAGSQGGA 779
                    .|.|.:.......|:......:.|:.|             .:|.|.         |:
Human   699 --------HLEEEEERNEKEGSDAKHLQRSLLEQE-------------NHSPLT---------GS 733

  Fly   780 GQQYSMRDRPLPATPSLTSVSSATNASKIYEPIHELIQQQQQLQQ 824
            ..:|.       .|...|...|..:||.:|   ..:::::::|||
Human   734 NMKYK-------TTNQSTEFLSFQDASSLY---RNILEKERELQQ 768

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek5NP_001245746.1 LRR_RI <76..160 CDD:238064 27/90 (30%)
leucine-rich repeat 76..100 CDD:275380 7/30 (23%)
LRR_8 99..159 CDD:290566 20/59 (34%)
leucine-rich repeat 101..124 CDD:275380 7/22 (32%)
LRR 122..145 CDD:197688 7/22 (32%)
leucine-rich repeat 125..148 CDD:275380 8/22 (36%)
LRR_8 148..207 CDD:290566 13/58 (22%)
leucine-rich repeat 149..172 CDD:275380 7/22 (32%)
leucine-rich repeat 173..196 CDD:275380 3/22 (14%)
LRR_8 197..>229 CDD:290566 8/32 (25%)
leucine-rich repeat 197..220 CDD:275380 6/23 (26%)
LRRCT 229..277 CDD:214507 13/53 (25%)
Ig 296..376 CDD:143165 17/110 (15%)
SLITRK6NP_115605.2 PLN00113 69..>494 CDD:331614 92/455 (20%)
leucine-rich repeat 69..89 CDD:275380 6/21 (29%)
LRR 1 89..110 6/20 (30%)
LRR_8 92..146 CDD:316378 17/53 (32%)
leucine-rich repeat 94..113 CDD:275380 6/18 (33%)
LRR 2 113..134 6/20 (30%)
leucine-rich repeat 114..137 CDD:275380 8/22 (36%)
LRR_8 137..195 CDD:316378 13/58 (22%)
LRR 3 137..158 6/20 (30%)
leucine-rich repeat 138..161 CDD:275380 7/22 (32%)
LRR 4 161..182 3/21 (14%)
leucine-rich repeat 162..177 CDD:275380 2/14 (14%)
LRR 5 184..205 6/20 (30%)
leucine-rich repeat 185..260 CDD:275380 19/78 (24%)
leucine-rich repeat 261..412 CDD:275380 21/150 (14%)
LRR 6 364..385 4/20 (20%)
leucine-rich repeat 366..388 CDD:275380 4/21 (19%)
LRR 7 388..409 4/20 (20%)
LRR_8 411..471 CDD:316378 10/64 (16%)
LRR 8 412..433 5/22 (23%)
leucine-rich repeat 413..436 CDD:275380 6/24 (25%)
LRR 9 436..457 2/20 (10%)
leucine-rich repeat 437..460 CDD:275380 3/22 (14%)
LRR_8 459..518 CDD:316378 14/81 (17%)
LRR 10 460..481 4/41 (10%)
leucine-rich repeat 461..482 CDD:275380 5/41 (12%)
LRR 11 483..504 6/21 (29%)
LRRCT 517..567 CDD:214507 12/81 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I4831
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.