DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek5 and RLP52

DIOPT Version :9

Sequence 1:NP_001245746.1 Gene:kek5 / 32930 FlyBaseID:FBgn0031016 Length:931 Species:Drosophila melanogaster
Sequence 2:NP_197963.1 Gene:RLP52 / 832660 AraportID:AT5G25910 Length:811 Species:Arabidopsis thaliana


Alignment Length:291 Identity:61/291 - (20%)
Similarity:104/291 - (35%) Gaps:96/291 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KNKALTKIPQDMSNEMQVLDFAHNQIP-ELRRE---------------------EFLLAGLPNVH 102
            ||.....||:::|..::.:|..|||:. :|.|.                     .|.|..:..:.
plant   475 KNHLSGSIPENISTSVKSIDIGHNQLAGKLPRSLVRISSLEVLNVESNKINDTFPFWLDSMQQLQ 539

  Fly   103 KIFLR-NCTIQEVHREAFKGLHILIELDLSGNRIRELHPGTF-------AGLEKLRNVIINNN-- 157
            .:.|| |.....:::..|..|.|   :|:|||......|..|       ..|.|:.:..:..|  
plant   540 VLVLRSNAFHGSINQNGFSKLRI---IDISGNHFNGTLPLDFFVNWTAMFSLGKIEDQYMGTNYM 601

  Fly   158 -------EIEVLPNHLFVN----LSFLSRIEFRNNRL-----RQV----QLHV-------FAG-- 193
                   .|.|:...:.:.    |:..:.|:|..|:.     |.|    :|||       |.|  
plant   602 RTNYYSDSIVVMIKGIALEMVRILNTFTTIDFSGNKFEGEIPRSVGLLKELHVLNLSNNGFTGHI 666

  Fly   194 ------TMALSAISLEQNRLSHLHKETFKDLQKLMHLSLQGNAWNCSCELQDFRDFAISKRLYTP 252
                  .:.|.::.:.||:||   .|...:|.||.:|:              :.:|:.::.:...
plant   667 PSSMGNLIELESLDVSQNKLS---GEIPPELGKLSYLA--------------YMNFSQNQFVGLV 714

  Fly   253 PTDCQEPPQLRGKLWSEVPSENFACRPRILG 283
            |...|...|         |..:||..||:.|
plant   715 PGGTQFQTQ---------PCSSFADNPRLFG 736

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek5NP_001245746.1 LRR_RI <76..160 CDD:238064 23/122 (19%)
leucine-rich repeat 76..100 CDD:275380 8/45 (18%)
LRR_8 99..159 CDD:290566 15/76 (20%)
leucine-rich repeat 101..124 CDD:275380 5/23 (22%)
LRR 122..145 CDD:197688 8/29 (28%)
leucine-rich repeat 125..148 CDD:275380 7/29 (24%)
LRR_8 148..207 CDD:290566 18/95 (19%)
leucine-rich repeat 149..172 CDD:275380 4/35 (11%)
leucine-rich repeat 173..196 CDD:275380 10/46 (22%)
LRR_8 197..>229 CDD:290566 10/31 (32%)
leucine-rich repeat 197..220 CDD:275380 7/22 (32%)
LRRCT 229..277 CDD:214507 6/47 (13%)
Ig 296..376 CDD:143165
RLP52NP_197963.1 PLN00113 30..>575 CDD:331614 23/102 (23%)
leucine-rich repeat 65..88 CDD:275380
leucine-rich repeat 89..112 CDD:275380
leucine-rich repeat 113..137 CDD:275380
leucine-rich repeat 138..185 CDD:275380
leucine-rich repeat 162..181 CDD:275380
leucine-rich repeat 212..236 CDD:275380
leucine-rich repeat 237..260 CDD:275380
leucine-rich repeat 261..283 CDD:275380
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..331 CDD:275380
leucine-rich repeat 332..355 CDD:275380
leucine-rich repeat 356..379 CDD:275380
leucine-rich repeat 380..403 CDD:275380
leucine-rich repeat 404..443 CDD:275380
leucine-rich repeat 444..467 CDD:275380
leucine-rich repeat 468..489 CDD:275380 5/13 (38%)
leucine-rich repeat 490..513 CDD:275380 6/22 (27%)
leucine-rich repeat 514..535 CDD:275380 2/20 (10%)
leucine-rich repeat 538..559 CDD:275380 4/20 (20%)
leucine-rich repeat 560..627 CDD:275380 14/69 (20%)
leucine-rich repeat 628..651 CDD:275380 5/22 (23%)
PLN00113 <640..743 CDD:331614 27/123 (22%)
leucine-rich repeat 652..675 CDD:275380 5/22 (23%)
leucine-rich repeat 676..699 CDD:275380 9/25 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.