| Sequence 1: | NP_001245746.1 | Gene: | kek5 / 32930 | FlyBaseID: | FBgn0031016 | Length: | 931 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_951020.1 | Gene: | Slitrk1 / 76965 | MGIID: | 2679446 | Length: | 696 | Species: | Mus musculus |
| Alignment Length: | 285 | Identity: | 63/285 - (22%) |
|---|---|---|---|
| Similarity: | 116/285 - (40%) | Gaps: | 54/285 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 18 LLLGVLVVLMALPPPTAGTTDWMQSCGTCHCQWNSGKKSADCKNKALTKI--------------- 67
Fly 68 ---------PQDMSNEMQV--LDFAHNQIPELRREEFLLAGLPNVHKIFLRNCTIQEVHREAFKG 121
Fly 122 LHILIELDLSGNRIRELHPGTFAGLEKLRNVIINNNEIEVLPNHLFVNLSFLSRIEFRNNRLRQV 186
Fly 187 QLHVFAGTMALSAISLEQNRLSHLHKETFKDLQKLMHLSLQGNAWNCSCELQDFRDFA--ISKRL 249
Fly 250 YTPPTDCQEPPQLRGKLWSEVPSEN 274 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek5 | NP_001245746.1 | LRR_RI | <76..160 | CDD:238064 | 26/85 (31%) |
| leucine-rich repeat | 76..100 | CDD:275380 | 7/25 (28%) | ||
| LRR_8 | 99..159 | CDD:290566 | 19/59 (32%) | ||
| leucine-rich repeat | 101..124 | CDD:275380 | 6/22 (27%) | ||
| LRR | 122..145 | CDD:197688 | 8/22 (36%) | ||
| leucine-rich repeat | 125..148 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 148..207 | CDD:290566 | 13/58 (22%) | ||
| leucine-rich repeat | 149..172 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 173..196 | CDD:275380 | 4/22 (18%) | ||
| LRR_8 | 197..>229 | CDD:290566 | 2/31 (6%) | ||
| leucine-rich repeat | 197..220 | CDD:275380 | 1/22 (5%) | ||
| LRRCT | 229..277 | CDD:214507 | 13/48 (27%) | ||
| Ig | 296..376 | CDD:143165 | |||
| Slitrk1 | NP_951020.1 | leucine-rich repeat | 39..60 | CDD:275380 | 4/20 (20%) |
| LRR 1 | 59..80 | 1/20 (5%) | |||
| leucine-rich repeat | 62..83 | CDD:275380 | 2/20 (10%) | ||
| LRR 2 | 83..104 | 5/22 (23%) | |||
| leucine-rich repeat | 84..107 | CDD:275380 | 7/24 (29%) | ||
| LRR 3 | 106..128 | 4/21 (19%) | |||
| LRR_8 | 108..166 | CDD:290566 | 19/57 (33%) | ||
| leucine-rich repeat | 108..131 | CDD:275380 | 6/22 (27%) | ||
| LRR 4 | 131..152 | 7/20 (35%) | |||
| leucine-rich repeat | 132..155 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 155..213 | CDD:290566 | 15/81 (19%) | ||
| LRR 5 | 155..176 | 9/20 (45%) | |||
| leucine-rich repeat | 156..177 | CDD:275380 | 8/20 (40%) | ||
| LRR 6 | 178..199 | 5/44 (11%) | |||
| TPKR_C2 | 212..>250 | CDD:301599 | 10/37 (27%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 268..317 | ||||
| leucine-rich repeat | 356..372 | CDD:275380 | |||
| LRR 7 | 376..397 | ||||
| leucine-rich repeat | 377..400 | CDD:275380 | |||
| LRR 8 | 400..421 | ||||
| leucine-rich repeat | 401..424 | CDD:275380 | |||
| LRR 9 | 424..445 | ||||
| LRR_8 | 425..483 | CDD:290566 | |||
| leucine-rich repeat | 425..448 | CDD:275380 | |||
| LRR 10 | 448..469 | ||||
| leucine-rich repeat | 449..472 | CDD:275380 | |||
| LRR_8 | 471..530 | CDD:290566 | |||
| LRR 11 | 472..493 | ||||
| leucine-rich repeat | 473..495 | CDD:275380 | |||
| LRR 12 | 495..516 | ||||
| leucine-rich repeat | 496..520 | CDD:275380 | |||
| TPKR_C2 | 529..579 | CDD:301599 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||