| Sequence 1: | NP_001245746.1 | Gene: | kek5 / 32930 | FlyBaseID: | FBgn0031016 | Length: | 931 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_003254.2 | Gene: | TLR1 / 7096 | HGNCID: | 11847 | Length: | 786 | Species: | Homo sapiens |
| Alignment Length: | 253 | Identity: | 55/253 - (21%) |
|---|---|---|---|
| Similarity: | 102/253 - (40%) | Gaps: | 42/253 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 59 CKNKALTKIPQDMSN---------------EMQVLDFAHNQIPELRREEFLLAGLPNVHKIFLRN 108
Fly 109 CTIQEVHREAFKG----LHILIELDLSGNRI-----RELHPGTFAGLEKLRNVIINNNEIEVLPN 164
Fly 165 HLFVNLSFLSRIEFRNNRLRQVQLHVFAGTMALSAISLEQNRLSHLHKETFKDLQKLMHLSLQGN 229
Fly 230 AWNCSCELQDF---RDFAISKRLYTPPTD--CQEPPQLRGKLWSEVPSENFACRPRIL 282 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek5 | NP_001245746.1 | LRR_RI | <76..160 | CDD:238064 | 16/92 (17%) |
| leucine-rich repeat | 76..100 | CDD:275380 | 5/23 (22%) | ||
| LRR_8 | 99..159 | CDD:290566 | 11/68 (16%) | ||
| leucine-rich repeat | 101..124 | CDD:275380 | 3/26 (12%) | ||
| LRR | 122..145 | CDD:197688 | 7/27 (26%) | ||
| leucine-rich repeat | 125..148 | CDD:275380 | 7/27 (26%) | ||
| LRR_8 | 148..207 | CDD:290566 | 12/58 (21%) | ||
| leucine-rich repeat | 149..172 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 173..196 | CDD:275380 | 4/22 (18%) | ||
| LRR_8 | 197..>229 | CDD:290566 | 8/31 (26%) | ||
| leucine-rich repeat | 197..220 | CDD:275380 | 6/22 (27%) | ||
| LRRCT | 229..277 | CDD:214507 | 15/52 (29%) | ||
| Ig | 296..376 | CDD:143165 | |||
| TLR1 | NP_003254.2 | leucine-rich repeat | 47..70 | CDD:275378 | |
| LRR 1 | 54..77 | ||||
| LRR_8 | 69..124 | CDD:316378 | |||
| leucine-rich repeat | 71..94 | CDD:275378 | |||
| LRR 2 | 78..101 | ||||
| leucine-rich repeat | 95..115 | CDD:275378 | |||
| LRR 3 | 102..125 | ||||
| leucine-rich repeat | 116..140 | CDD:275378 | |||
| LRR 4 | 126..150 | ||||
| leucine-rich repeat | 141..152 | CDD:275378 | |||
| LRR 5 | 151..175 | ||||
| LRR 6 | 176..199 | ||||
| LRR 7 | 200..223 | ||||
| LRR 8 | 224..250 | ||||
| LRR 9 | 251..278 | ||||
| LRR 10 | 279..308 | ||||
| LRR 11 | 309..337 | ||||
| Interaction with bacterial lipopeptide | 313..316 | ||||
| LRR 12 | 338..361 | 5/17 (29%) | |||
| PLN00113 | <352..>560 | CDD:331614 | 47/220 (21%) | ||
| leucine-rich repeat | 352..373 | CDD:275380 | 3/20 (15%) | ||
| LRR 13 | 362..388 | 5/25 (20%) | |||
| leucine-rich repeat | 374..399 | CDD:275380 | 5/24 (21%) | ||
| LRR 14 | 389..414 | 1/27 (4%) | |||
| leucine-rich repeat | 400..424 | CDD:275380 | 3/26 (12%) | ||
| LRR 15 | 415..437 | 6/21 (29%) | |||
| leucine-rich repeat | 425..446 | CDD:275380 | 7/27 (26%) | ||
| LRR 16 | 438..457 | 4/25 (16%) | |||
| leucine-rich repeat | 447..469 | CDD:275380 | 5/22 (23%) | ||
| LRR 17 | 458..478 | 4/20 (20%) | |||
| leucine-rich repeat | 470..492 | CDD:275380 | 4/23 (17%) | ||
| LRR 18 | 479..500 | 4/22 (18%) | |||
| leucine-rich repeat | 494..515 | CDD:275380 | 4/20 (20%) | ||
| LRR 19 | 501..524 | 5/22 (23%) | |||
| LRRCT | 553..577 | CDD:279765 | 5/23 (22%) | ||
| TIR | 636..779 | CDD:214587 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||