| Sequence 1: | NP_001245746.1 | Gene: | kek5 / 32930 | FlyBaseID: | FBgn0031016 | Length: | 931 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001034730.1 | Gene: | lgi2a / 654827 | ZFINID: | ZDB-GENE-060217-2 | Length: | 536 | Species: | Danio rerio |
| Alignment Length: | 262 | Identity: | 53/262 - (20%) |
|---|---|---|---|
| Similarity: | 100/262 - (38%) | Gaps: | 60/262 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 17 LLLLGVLVVLMALPPPTAGTTDWMQSC-GTCHCQWNSGKKSADCKNKALTKIPQDMSNEMQVLDF 80
Fly 81 AHNQIPELRREEFLLAGLPNVHKIFLRNCTIQEVHREAFKGLHILIELDLSGNRIRELHPGTFAG 145
Fly 146 LEKLRNVIINNNEIEVLPNHLFVNLSFLSRIEFRNNRLRQVQLHVFAGTMALSAISLEQNRLSHL 210
Fly 211 HKETFKDLQKLMHLSLQGNAWNCSCELQDFRDFAISKRLYTPPTDCQEPPQLRGKLWSEVPSENF 275
Fly 276 AC 277 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek5 | NP_001245746.1 | LRR_RI | <76..160 | CDD:238064 | 20/83 (24%) |
| leucine-rich repeat | 76..100 | CDD:275380 | 3/23 (13%) | ||
| LRR_8 | 99..159 | CDD:290566 | 17/59 (29%) | ||
| leucine-rich repeat | 101..124 | CDD:275380 | 6/22 (27%) | ||
| LRR | 122..145 | CDD:197688 | 6/22 (27%) | ||
| leucine-rich repeat | 125..148 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 148..207 | CDD:290566 | 8/58 (14%) | ||
| leucine-rich repeat | 149..172 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 173..196 | CDD:275380 | 0/22 (0%) | ||
| LRR_8 | 197..>229 | CDD:290566 | 5/31 (16%) | ||
| leucine-rich repeat | 197..220 | CDD:275380 | 2/22 (9%) | ||
| LRRCT | 229..277 | CDD:214507 | 9/47 (19%) | ||
| Ig | 296..376 | CDD:143165 | |||
| lgi2a | NP_001034730.1 | LRR_8 | 54..112 | CDD:290566 | 13/59 (22%) |
| LRR_8 | 100..158 | CDD:290566 | 20/105 (19%) | ||
| LRR_4 | 100..140 | CDD:289563 | 11/39 (28%) | ||
| leucine-rich repeat | 102..125 | CDD:275378 | 7/22 (32%) | ||
| LRR_4 | 126..>158 | CDD:289563 | 13/79 (16%) | ||
| leucine-rich repeat | 126..149 | CDD:275378 | 10/70 (14%) | ||
| leucine-rich repeat | 150..162 | CDD:275378 | 5/11 (45%) | ||
| LRRCT | 158..198 | CDD:214507 | 8/39 (21%) | ||
| EPTP | 210..251 | CDD:281697 | |||
| EPTP | 257..297 | CDD:281697 | |||
| EPTP | 302..348 | CDD:281697 | |||
| EPTP | 351..393 | CDD:281697 | |||
| EPTP | 398..439 | CDD:281697 | |||
| EPTP | 443..484 | CDD:281697 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||