DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek5 and LRRC19

DIOPT Version :9

Sequence 1:NP_001245746.1 Gene:kek5 / 32930 FlyBaseID:FBgn0031016 Length:931 Species:Drosophila melanogaster
Sequence 2:NP_075052.1 Gene:LRRC19 / 64922 HGNCID:23379 Length:370 Species:Homo sapiens


Alignment Length:451 Identity:92/451 - (20%)
Similarity:163/451 - (36%) Gaps:147/451 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SGKKSADCK--NKALTKIPQDMSNEMQVLDFAHNQIPELRREEFLLAGLPNVHKIFLRNCTIQEV 114
            |.|:...|.  .|..|.||.|:..::.:||.::|||                        |:...
Human    24 SSKREVQCNFTEKNYTLIPADIKKDVTILDLSYNQI------------------------TLNGT 64

  Fly   115 HREAFKGLHILIELDLSGNRIRELHPGTFAGLEKLRNVIINNNEIEVLPNHLFVNLSFLSRIEFR 179
            .....:...:|.||.|..|::..||...|..|..|..:.|..|.|.|:....|:.|:.|.::...
Human    65 DTRVLQTYFLLTELYLIENKVTILHNNGFGNLSSLEILNICRNSIYVIQQGAFLGLNKLKQLYLC 129

  Fly   180 NNRLRQVQLHVFAGTMALSAISLEQNRLSHLHKETFKDLQKLMHL---SLQGNAWNCSCELQDFR 241
            .|::.|:...||....:|..::|:.|.:|:|      |:..|.||   :|.||.|||||.|.:.:
Human   130 QNKIEQLNADVFVPLRSLKLLNLQGNLISYL------DVPPLFHLELITLYGNLWNCSCSLFNLQ 188

  Fly   242 DFAISKRLYTPPTDCQEPPQLRGKLWSEVPSENFACRPRILGSVRSFIEANHDNISLPCRIVGSP 306
            :                        |                       .|..|::|       .
Human   189 N------------------------W-----------------------LNTSNVTL-------E 199

  Fly   307 RPNVTWVYNKRPLQQYDPRVRVLTSVEQMPEQ-------PSQVLTSELRIVGVRASDKGAYTCVA 364
            ..|:|.......||.|        :::.:|.:       ||.| |.:|.|               
Human   200 NENITMCSYPNSLQSY--------NIKTVPHKAECHSKFPSSV-TEDLYI--------------- 240

  Fly   365 DNRGGRAEAEFQLLVSGDYAGAVSASDGMGMGAIGAPTIDPQTNMFLI-ICLIITTLLLLLLVAV 428
                     .||.:.:..:.   |:|:.:...:...|.  .::..||: :.:.:.|..||:.:|:
Human   241 ---------HFQPISNSIFN---SSSNNLTRNSEHEPL--GKSWAFLVGVVVTVLTTSLLIFIAI 291

  Fly   429 LTLFWY-------CRRIKTYQKDT--TMMSGDGLISSKMDKTHNGSMLEGSVIMEMQKSLL 480
            ....||       ..|::.::.:|  ...:|:....|::.:|::.   |.:||.|...|.:
Human   292 KCPIWYNILLSYNHHRLEEHEAETYEDGFTGNPSSLSQIPETNSE---ETTVIFEQLHSFV 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek5NP_001245746.1 LRR_RI <76..160 CDD:238064 18/83 (22%)
leucine-rich repeat 76..100 CDD:275380 5/23 (22%)
LRR_8 99..159 CDD:290566 13/59 (22%)
leucine-rich repeat 101..124 CDD:275380 1/22 (5%)
LRR 122..145 CDD:197688 8/22 (36%)
leucine-rich repeat 125..148 CDD:275380 9/22 (41%)
LRR_8 148..207 CDD:290566 15/58 (26%)
leucine-rich repeat 149..172 CDD:275380 7/22 (32%)
leucine-rich repeat 173..196 CDD:275380 5/22 (23%)
LRR_8 197..>229 CDD:290566 10/34 (29%)
leucine-rich repeat 197..220 CDD:275380 6/22 (27%)
LRRCT 229..277 CDD:214507 8/47 (17%)
Ig 296..376 CDD:143165 13/86 (15%)
LRRC19NP_075052.1 LRR 1. /evidence=ECO:0000255 46..71 6/48 (13%)
leucine-rich repeat 49..71 CDD:275378 6/45 (13%)
LRR 2. /evidence=ECO:0000255 72..95 8/22 (36%)
leucine-rich repeat 75..98 CDD:275378 9/22 (41%)
LRR 3. /evidence=ECO:0000255 96..119 7/22 (32%)
LRR_8 97..157 CDD:316378 15/59 (25%)
leucine-rich repeat 99..122 CDD:275378 7/22 (32%)
LRR 4. /evidence=ECO:0000255 120..143 6/22 (27%)
leucine-rich repeat 123..146 CDD:275378 5/22 (23%)
LRR 5. /evidence=ECO:0000255 145..168 7/28 (25%)
leucine-rich repeat 147..160 CDD:275378 4/12 (33%)
leucine-rich repeat 168..180 CDD:275378 5/11 (45%)
TPKR_C2 176..227 CDD:326558 17/112 (15%)
LRR19-TM 257..370 CDD:317577 19/98 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.