Sequence 1: | NP_001245746.1 | Gene: | kek5 / 32930 | FlyBaseID: | FBgn0031016 | Length: | 931 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_065913.1 | Gene: | LRFN1 / 57622 | HGNCID: | 29290 | Length: | 771 | Species: | Homo sapiens |
Alignment Length: | 399 | Identity: | 108/399 - (27%) |
---|---|---|---|
Similarity: | 155/399 - (38%) | Gaps: | 73/399 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 PPPT---------AGTTDWMQSCGTCHCQWNSGKKSADCKNKALTKIPQDMSNEMQVLDFAHNQI 85
Fly 86 PELRREEFLLAGLPN-VHKIFLRNCTIQEVHREAFKGLHILIELDLSGNRIRELHPGTFAGLEKL 149
Fly 150 RNVIINNNEIEVLPNHLFVNLSFLSRIE---FRNNRLRQVQLHVFAGTMALSAISLEQNRLSHLH 211
Fly 212 KETFKDLQKLMHL--------------------------------SLQGNAWNCSCELQDFRDFA 244
Fly 245 ISKRLYTPPTDCQEPPQLRGKLWSEVPSENFACRPRIL----GSVRSFIEANHDNISLPCRIVGS 305
Fly 306 PRPNVTWVYNKRPLQQYDPRVRVLTSVEQMPEQPSQVLTSELRIVGVRASDKGAYTCVADNRGGR 370
Fly 371 AEAEFQLLV 379 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek5 | NP_001245746.1 | LRR_RI | <76..160 | CDD:238064 | 30/84 (36%) |
leucine-rich repeat | 76..100 | CDD:275380 | 7/23 (30%) | ||
LRR_8 | 99..159 | CDD:290566 | 23/60 (38%) | ||
leucine-rich repeat | 101..124 | CDD:275380 | 10/22 (45%) | ||
LRR | 122..145 | CDD:197688 | 7/22 (32%) | ||
leucine-rich repeat | 125..148 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 148..207 | CDD:290566 | 16/61 (26%) | ||
leucine-rich repeat | 149..172 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 173..196 | CDD:275380 | 5/25 (20%) | ||
LRR_8 | 197..>229 | CDD:290566 | 11/63 (17%) | ||
leucine-rich repeat | 197..220 | CDD:275380 | 7/22 (32%) | ||
LRRCT | 229..277 | CDD:214507 | 14/47 (30%) | ||
Ig | 296..376 | CDD:143165 | 27/79 (34%) | ||
LRFN1 | NP_065913.1 | LRR_RI | <65..174 | CDD:238064 | 37/113 (33%) |
LRR_8 | 65..125 | CDD:290566 | 21/62 (34%) | ||
LRR 1 | 66..87 | 6/22 (27%) | |||
leucine-rich repeat | 67..90 | CDD:275380 | 7/24 (29%) | ||
LRR 2 | 90..111 | 9/21 (43%) | |||
leucine-rich repeat | 91..114 | CDD:275380 | 10/23 (43%) | ||
LRR_8 | 113..174 | CDD:290566 | 20/62 (32%) | ||
LRR 3 | 114..135 | 6/20 (30%) | |||
leucine-rich repeat | 115..138 | CDD:275380 | 8/22 (36%) | ||
LRR 4 | 138..159 | 7/22 (32%) | |||
leucine-rich repeat | 139..163 | CDD:275380 | 9/25 (36%) | ||
LRR_8 | 162..222 | CDD:290566 | 14/59 (24%) | ||
LRR 5 | 163..184 | 3/20 (15%) | |||
leucine-rich repeat | 164..187 | CDD:275380 | 3/22 (14%) | ||
LRR_4 | 165..203 | CDD:289563 | 7/37 (19%) | ||
LRR 6 | 187..208 | 6/20 (30%) | |||
leucine-rich repeat | 188..211 | CDD:275380 | 7/22 (32%) | ||
LRR 7 | 211..232 | 3/20 (15%) | |||
leucine-rich repeat | 212..230 | CDD:275380 | 2/17 (12%) | ||
LRRCT | 252..>284 | CDD:214507 | 11/35 (31%) | ||
IG_like | 310..385 | CDD:214653 | 28/89 (31%) | ||
Ig | 314..387 | CDD:299845 | 27/87 (31%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 397..422 | ||||
fn3 | 426..500 | CDD:278470 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 654..743 | ||||
PDZ-binding | 768..771 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | otm41933 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |