DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek5 and AgaP_AGAP007059

DIOPT Version :9

Sequence 1:NP_001245746.1 Gene:kek5 / 32930 FlyBaseID:FBgn0031016 Length:931 Species:Drosophila melanogaster
Sequence 2:XP_001688062.1 Gene:AgaP_AGAP007059 / 5666869 VectorBaseID:AGAP007059 Length:1098 Species:Anopheles gambiae


Alignment Length:235 Identity:72/235 - (30%)
Similarity:110/235 - (46%) Gaps:35/235 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KNKALTKIPQDMS--NEMQVLDFAHNQIPELRREEFLLAGLPNVHKIFLRNCTIQEVHREAFKGL 122
            ||:..|..||...  :.:|.:||:.|.:..|  .:...|..|.:.|:.|.:..:||:.:|.|..:
Mosquito    84 KNQLETIDPQTFRGISYVQEIDFSGNLLRTL--PDLFFAEKPKLKKLSLADNFLQELKKETFGEM 146

  Fly   123 HILIELDLSGNRIRELHPGTFAGLEKLRNVIINNNEIEVLPNHLFVNLSFLSRIEFRNNRLRQVQ 187
            ..|.|||||||.:|.|..|||.|..:|..:::.||.:||:....|.||..|..:...||.|:.:.
Mosquito   147 TALQELDLSGNMLRALVAGTFDGPWQLEQLLLQNNRLEVIEATAFENLVKLRGLNLSNNNLKVLP 211

  Fly   188 LHVFAGTMALSAISLEQNRLSHLHKETFKDLQKLMHLSLQGNA---------WNCSCELQDFRDF 243
            ..||.....|..:.|:||.||||...||::..:|:.::|..|.         .|    |.|.:.|
Mosquito   212 ATVFNSMGVLRELELQQNYLSHLDSATFEENLRLVMINLDNNTIATLQPALIQN----LTDLQRF 272

  Fly   244 AI--------SKRLYTPPTDCQEPPQLRGKLWSEVPSENF 275
            :|        ..:|:...||.:       :||.   |.||
Mosquito   273 SIEYNQLQELDVQLFAHSTDLK-------RLWL---SGNF 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek5NP_001245746.1 LRR_RI <76..160 CDD:238064 30/83 (36%)
leucine-rich repeat 76..100 CDD:275380 6/23 (26%)
LRR_8 99..159 CDD:290566 24/59 (41%)
leucine-rich repeat 101..124 CDD:275380 6/22 (27%)
LRR 122..145 CDD:197688 13/22 (59%)
leucine-rich repeat 125..148 CDD:275380 14/22 (64%)
LRR_8 148..207 CDD:290566 18/58 (31%)
leucine-rich repeat 149..172 CDD:275380 8/22 (36%)
leucine-rich repeat 173..196 CDD:275380 6/22 (27%)
LRR_8 197..>229 CDD:290566 12/31 (39%)
leucine-rich repeat 197..220 CDD:275380 10/22 (45%)
LRRCT 229..277 CDD:214507 14/64 (22%)
Ig 296..376 CDD:143165
AgaP_AGAP007059XP_001688062.1 leucine-rich repeat 29..52 CDD:275380
LRR_8 53..111 CDD:290566 9/26 (35%)
leucine-rich repeat 53..76 CDD:275380
leucine-rich repeat 77..100 CDD:275380 5/15 (33%)
LRR_RI 80..377 CDD:238064 72/235 (31%)
leucine-rich repeat 101..124 CDD:275380 6/24 (25%)
LRR_8 123..183 CDD:290566 24/59 (41%)
leucine-rich repeat 125..148 CDD:275380 6/22 (27%)
leucine-rich repeat 149..172 CDD:275380 14/22 (64%)
LRR_8 172..231 CDD:290566 18/58 (31%)
leucine-rich repeat 173..196 CDD:275380 8/22 (36%)
leucine-rich repeat 197..220 CDD:275380 6/22 (27%)
LRR_8 221..279 CDD:290566 18/61 (30%)
leucine-rich repeat 221..244 CDD:275380 10/22 (45%)
leucine-rich repeat 245..268 CDD:275380 5/26 (19%)
leucine-rich repeat 269..292 CDD:275380 3/22 (14%)
LRR_8 293..351 CDD:290566 5/20 (25%)
leucine-rich repeat 293..316 CDD:275380 5/20 (25%)
leucine-rich repeat 317..340 CDD:275380
leucine-rich repeat 341..361 CDD:275380
LRR_RI 365..>542 CDD:238064
leucine-rich repeat 365..412 CDD:275380
LRR_8 396..447 CDD:290566
leucine-rich repeat 413..434 CDD:275380
leucine-rich repeat 437..459 CDD:275380
LRR_8 439..494 CDD:290566
leucine-rich repeat 460..480 CDD:275380
leucine-rich repeat 484..506 CDD:275380
LRR_8 506..558 CDD:290566
leucine-rich repeat 507..530 CDD:275380
leucine-rich repeat 531..554 CDD:275380
leucine-rich repeat 555..578 CDD:275380
leucine-rich repeat 579..602 CDD:275380
leucine-rich repeat 603..626 CDD:275380
leucine-rich repeat 650..673 CDD:275380
leucine-rich repeat 674..697 CDD:275380
leucine-rich repeat 698..719 CDD:275380
leucine-rich repeat 720..743 CDD:275380
LRR_8 742..803 CDD:290566
leucine-rich repeat 746..768 CDD:275380
LRR_RI <755..912 CDD:238064
leucine-rich repeat 769..792 CDD:275380
LRR_8 791..851 CDD:290566
leucine-rich repeat 793..816 CDD:275380
leucine-rich repeat 817..840 CDD:275380
LRR_8 840..899 CDD:290566
leucine-rich repeat 841..864 CDD:275380
LRR <856..>1095 CDD:227223
leucine-rich repeat 865..888 CDD:275380
leucine-rich repeat 889..912 CDD:275380
leucine-rich repeat 913..936 CDD:275380
leucine-rich repeat 979..1000 CDD:275380
leucine-rich repeat 1051..1074 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.