DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek5 and lingo2b

DIOPT Version :9

Sequence 1:NP_001245746.1 Gene:kek5 / 32930 FlyBaseID:FBgn0031016 Length:931 Species:Drosophila melanogaster
Sequence 2:NP_001139054.1 Gene:lingo2b / 564052 ZFINID:ZDB-GENE-080723-57 Length:607 Species:Danio rerio


Alignment Length:557 Identity:124/557 - (22%)
Similarity:201/557 - (36%) Gaps:169/557 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KSADCKNKALTKIPQDM---SNEMQVLDFAHNQI--------PELRREEFL-------------- 94
            :|...::..||.:|:..   .:|:.:||.:.|::        .|.||...|              
Zfish   107 RSLRLRSNQLTLLPRGALAGLSELTLLDVSQNRLVILLDYGFEEQRRLRVLELSDNELVFIAPRA 171

  Fly    95 LAGLPNVHKIFLRNCTIQEVHREAFKGLHILIELDLSGNRIRELHPGTFAGLEKLRNVII----- 154
            .:||.::..:.|:.|.:..|...|...||.|..|.|....|.||...||.||.:|:::.:     
Zfish   172 FSGLASLRSLTLQRCNLSTVPTHALAHLHGLTSLRLRDLGIAELQAHTFKGLPRLKHLEVDRWPL 236

  Fly   155 ----------------------NNNEIEVLPNHLF---VNLSF-------------LSRIE---F 178
                                  |...:.|:.|.|:   :|||:             :.|:|   .
Zfish   237 LEGFPTSALQGLNLSTLSITHTNLTSVPVVTNLLYLTHLNLSYSRIRVLPAGWLRGMDRLEVLRV 301

  Fly   179 RNNRLRQVQLHVFAGTMALSAISLEQNRLSHLHKETFKDLQKLMHLSLQGNAWNCSCELQDFRDF 243
            |...|..|:...|.|..:|..:.|..|||:.|.:..|...:.|..|.:..|...|.|.|:    :
Zfish   302 RQANLLSVEPQAFQGASSLRILDLCYNRLATLERSVFPVTEALQTLLIGQNPLVCDCRLR----W 362

  Fly   244 AISKRLYTPP-------TDCQEPPQLRGK-----LWSEVPSENFACRPRILGSVRSFIEANHDNI 296
            .:.:   |||       .:|..|..|.||     :.:::.......:||::.......:|.....
Zfish   363 LLER---TPPLLYGDVQPECSAPAPLAGKPLRDLVEAQISRYVICTKPRVISMASYPAQAEEGQR 424

  Fly   297 S-LPCRIVGSPRPNVTWVYNKRPLQQY-----DPRVRVLT--SVEQMPEQPSQVLTSELRIVGVR 353
            : |.|...|:|.|:|:|:   .||:::     ..||.|.|  |:|....:|              
Zfish   425 AWLYCSADGAPPPSVSWL---TPLRRHITTKSTGRVVVHTNGSLEFRMAEP-------------- 472

  Fly   354 ASDKGAYTCVADNRGGRAEAEFQLLV--SGDYAGAVSASDGMGMGAIGAPTIDPQTNMFLI---- 412
             .|.|.|.|||.|..|.|.....|.|  ||....|:.|:...        ..||..|..||    
Zfish   473 -QDSGMYVCVASNPAGNATLSVTLAVKTSGIRDRALYANRSF--------LFDPDYNSSLINGTE 528

  Fly   413 -----ICLIITTLLL-----------LLLVAVLTLFWYCRRIKTYQKDTTMMSGDGLISSKMDKT 461
                 :.|..||:|:           ::|...|.||.:.|             |.|        .
Zfish   529 EYTIRVVLDFTTILVSTAMGCLSFLGVVLFCFLLLFAWSR-------------GKG--------K 572

  Fly   462 HNGSMLEGSVIMEMQKSLLNEVNPVEKPPRRTDIESV 498
            |.|| ::...:...:|...:|:... ..|||.:::.:
Zfish   573 HRGS-VDIQYVPRKRKGANSELTET-SGPRRVNMKMI 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek5NP_001245746.1 LRR_RI <76..160 CDD:238064 27/132 (20%)
leucine-rich repeat 76..100 CDD:275380 9/45 (20%)
LRR_8 99..159 CDD:290566 18/86 (21%)
leucine-rich repeat 101..124 CDD:275380 5/22 (23%)
LRR 122..145 CDD:197688 10/22 (45%)
leucine-rich repeat 125..148 CDD:275380 10/22 (45%)
LRR_8 148..207 CDD:290566 18/104 (17%)
leucine-rich repeat 149..172 CDD:275380 7/52 (13%)
leucine-rich repeat 173..196 CDD:275380 7/25 (28%)
LRR_8 197..>229 CDD:290566 9/31 (29%)
leucine-rich repeat 197..220 CDD:275380 7/22 (32%)
LRRCT 229..277 CDD:214507 12/59 (20%)
Ig 296..376 CDD:143165 25/87 (29%)
lingo2bNP_001139054.1 LRRNT 26..58 CDD:214470
leucine-rich repeat 37..60 CDD:275380
LRR_8 59..116 CDD:290566 1/8 (13%)
leucine-rich repeat 61..81 CDD:275380
LRR_RI <103..214 CDD:238064 24/106 (23%)
LRR_8 104..188 CDD:290566 16/80 (20%)
leucine-rich repeat 106..129 CDD:275380 4/21 (19%)
leucine-rich repeat 130..153 CDD:275380 4/22 (18%)
leucine-rich repeat 154..177 CDD:275380 3/22 (14%)
leucine-rich repeat 178..201 CDD:275380 5/22 (23%)
LRR_8 201..260 CDD:290566 11/58 (19%)
leucine-rich repeat 202..225 CDD:275380 10/22 (45%)
leucine-rich repeat 226..271 CDD:275380 4/44 (9%)
LRR_8 272..330 CDD:290566 13/57 (23%)
leucine-rich repeat 272..295 CDD:275380 3/22 (14%)
leucine-rich repeat 296..319 CDD:275380 6/22 (27%)
leucine-rich repeat 320..338 CDD:275380 6/17 (35%)
leucine-rich repeat 344..356 CDD:275378 3/11 (27%)
LRRCT 352..394 CDD:214507 12/48 (25%)
IG_like 419..497 CDD:214653 27/95 (28%)
Ig 422..497 CDD:299845 26/92 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I12360
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.