DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek5 and lrit1b

DIOPT Version :9

Sequence 1:NP_001245746.1 Gene:kek5 / 32930 FlyBaseID:FBgn0031016 Length:931 Species:Drosophila melanogaster
Sequence 2:NP_001036218.1 Gene:lrit1b / 553432 ZFINID:ZDB-GENE-060616-45 Length:654 Species:Danio rerio


Alignment Length:428 Identity:100/428 - (23%)
Similarity:156/428 - (36%) Gaps:91/428 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GVLVVLMALPPPTAGTTDWMQSCGTCHCQ-------WNSGKKSAD--CKNKALTKIPQDMSNEMQ 76
            ||.:.|...|          ..||:|..|       .:.|.||..  |.:..||.||        
Zfish     8 GVALALCCFP----------LLCGSCPAQCSCFYHKLSDGSKSRSVLCNDPDLTDIP-------- 54

  Fly    77 VLDFAHNQIPELRREEFLLAGLPNVHKIFLRNCTIQEVHREAFKGLHILIELDLSGNRIRELHPG 141
                          :.|.|    :..|:.:...::..:....|:.|..|..|.:|.|.:..:.|.
Zfish    55 --------------DNFPL----DASKLRIEKTSLSRISSAPFQQLSSLEYLWISFNSLSSISPD 101

  Fly   142 TFAGLEKLRNVIINNNEIEVLPNHLFVNLSFLSRIEFRNNRLRQVQLHVFAGTMALSAISLEQNR 206
            ||.||..|..:.::.|.:...|....:::..|..::..||::..:..........|:.:.|..|.
Zfish   102 TFRGLYALDELRMDGNVLTSFPWECLLDMPSLRLLDLHNNKISSIPAEATLYIRNLTYLDLSSNS 166

  Fly   207 LSHLHKET----FKDLQKL------MHLSLQGNAWNCSCELQD---FRDFAISKRLYTPP-TDCQ 257
            |:.:..|.    |.....|      |.|.|..|.|.|.|.|.|   |:.|..|...:... ..|.
Zfish   167 LTTVPPEVLMSWFSPKPPLDAEGSRMILGLHDNPWQCDCRLFDLVQFQKFPSSSVAFIDTGLRCA 231

  Fly   258 EPPQLRGKLWSEVPSENFACR-PRI---LGSVRSFIEANHDNISLPCRIVGSPRPNVTWV-YNKR 317
            ||..|.|.|:|:  :|...|: ||:   :..|||.|   .:|:.|.|..:|.|.|.::|. .:.:
Zfish   232 EPESLSGVLFSD--AELRRCQIPRVHTAVARVRSSI---GNNVLLRCGTIGVPIPELSWARADGK 291

  Fly   318 PLQQYDPRVRVLTSVEQMPEQPSQVLTSELRIVGVRASDKGAYTCVADNRGGRAEAEFQLLVSGD 382
            |          :....|.......::.|.|.:..|...|.|.|.|.|.|..|.|:|...|::|..
Zfish   292 P----------MNGTVQQEVSKEGIIWSILSVPAVSYRDSGKYVCKATNFVGSADAIISLVISDT 346

  Fly   383 Y---AGAVSASDGMGMGAIG---------APTIDPQTN 408
            :   ......|.|...|..|         |..:.|.|:
Zfish   347 WQIDEAVAKRSHGKKSGGFGRAAYQEKLIARYVPPSTS 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek5NP_001245746.1 LRR_RI <76..160 CDD:238064 16/83 (19%)
leucine-rich repeat 76..100 CDD:275380 2/23 (9%)
LRR_8 99..159 CDD:290566 14/59 (24%)
leucine-rich repeat 101..124 CDD:275380 3/22 (14%)
LRR 122..145 CDD:197688 8/22 (36%)
leucine-rich repeat 125..148 CDD:275380 9/22 (41%)
LRR_8 148..207 CDD:290566 9/58 (16%)
leucine-rich repeat 149..172 CDD:275380 3/22 (14%)
leucine-rich repeat 173..196 CDD:275380 3/22 (14%)
LRR_8 197..>229 CDD:290566 10/41 (24%)
leucine-rich repeat 197..220 CDD:275380 6/26 (23%)
LRRCT 229..277 CDD:214507 17/51 (33%)
Ig 296..376 CDD:143165 20/80 (25%)
lrit1bNP_001036218.1 LRR_RI <59..168 CDD:238064 22/112 (20%)
leucine-rich repeat 64..84 CDD:275380 2/19 (11%)
LRR_8 83..143 CDD:290566 15/59 (25%)
leucine-rich repeat 85..108 CDD:275380 9/22 (41%)
leucine-rich repeat 109..132 CDD:275380 3/22 (14%)
LRR_8 131..>176 CDD:290566 8/44 (18%)
LRR_4 131..172 CDD:289563 7/40 (18%)
leucine-rich repeat 133..156 CDD:275380 3/22 (14%)
leucine-rich repeat 157..175 CDD:275380 5/17 (29%)
leucine-rich repeat 185..203 CDD:275378 6/17 (35%)
LRRCT 199..243 CDD:214507 15/43 (35%)
I-set 252..343 CDD:254352 28/103 (27%)
IGc2 265..333 CDD:197706 19/80 (24%)
FN3 459..526 CDD:214495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5089
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25552
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.