DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek5 and dusp4

DIOPT Version :9

Sequence 1:NP_001245746.1 Gene:kek5 / 32930 FlyBaseID:FBgn0031016 Length:931 Species:Drosophila melanogaster
Sequence 2:NP_001016109.1 Gene:dusp4 / 548863 XenbaseID:XB-GENE-1007215 Length:388 Species:Xenopus tropicalis


Alignment Length:150 Identity:27/150 - (18%)
Similarity:56/150 - (37%) Gaps:39/150 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   462 HNGSMLEGSVIMEMQKSLLNEVNPVEKPPRR----TDIESV------DGGDDVLEIKKTLLDDTV 516
            |:...::|||.:        ..|.:.:  ||    ..:|.:      :|.::||...::.|...:
 Frog    51 HSAGFIQGSVNV--------RCNTIVR--RRAKGSVSLEQILPPGCKEGEEEVLSRLRSGLYSAI 105

  Fly   517 YV-------ANHSRDEEAVSVAMS----DTTTTP--------RSRHTYVDDAYANSLPPDLLAFP 562
            .|       |:..|::..|.:.:.    ||.:|.        ...|:...:..|.:...:.::.|
 Frog   106 IVYDERSPRADALREDSTVYLVVQALRRDTDSTDICLLKGGYERFHSEYPEFCAKTKSINSISLP 170

  Fly   563 ARVPPTSPSMQSSQSNIPDQ 582
            |.:.|......|..:.:.||
 Frog   171 ASIEPAGIGCSSCTTPLHDQ 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek5NP_001245746.1 LRR_RI <76..160 CDD:238064
leucine-rich repeat 76..100 CDD:275380
LRR_8 99..159 CDD:290566
leucine-rich repeat 101..124 CDD:275380
LRR 122..145 CDD:197688
leucine-rich repeat 125..148 CDD:275380
LRR_8 148..207 CDD:290566
leucine-rich repeat 149..172 CDD:275380
leucine-rich repeat 173..196 CDD:275380
LRR_8 197..>229 CDD:290566
leucine-rich repeat 197..220 CDD:275380
LRRCT 229..277 CDD:214507
Ig 296..376 CDD:143165
dusp4NP_001016109.1 DSP_MapKP 9..158 CDD:238723 20/116 (17%)
DSP_DUSP4 193..333 CDD:350488
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.