DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek5 and lingo1b

DIOPT Version :9

Sequence 1:NP_001245746.1 Gene:kek5 / 32930 FlyBaseID:FBgn0031016 Length:931 Species:Drosophila melanogaster
Sequence 2:NP_001004576.1 Gene:lingo1b / 447837 ZFINID:ZDB-GENE-040912-136 Length:622 Species:Danio rerio


Alignment Length:587 Identity:117/587 - (19%)
Similarity:193/587 - (32%) Gaps:198/587 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 MILLLLGVLVVLMALPPPTAGTTDWMQSCGTCHCQWNSGKKSADCKNKALTKIPQDMSNEMQVLD 79
            :::|:||.::...|...|:             .|:.::.::|..|..:.|..:|:.:..:.::||
Zfish    28 ILILMLGTVLSGSATGCPS-------------RCECSAQERSVVCHRRKLITLPEGIPIDTRLLD 79

  Fly    80 FAHNQIPELRREEFL----------------------LAGLPNVHKIFLRNCTIQEVHREAFKGL 122
            .:.|::..:..||||                      .:.|..:..:.|||..::.:....|.||
Zfish    80 LSKNRLKAINPEEFLNYPQLEDLQLNENIISVIEPGAFSNLLGLRTLGLRNNNLKLIQLGVFTGL 144

  Fly   123 HILIELDLSGNRI--------------RELHPG----------TFAGLE---------------- 147
            ..|..||:|.|:|              :||..|          .|.||.                
Zfish   145 SNLTRLDISENKIVILLDYMFQELYNLKELEVGDNDLVFISHRAFHGLSSLEQLTMERCNLTSVP 209

  Fly   148 -------------KLR----NVI---------------------------------------INN 156
                         |||    |||                                       |.|
Zfish   210 TEAFSHLHNLLTLKLRHLNVNVIRDFSFRRLYRLKILEIANWPLLESLTAKSLHGLNITTLSITN 274

  Fly   157 NEIEVLP----NHL----FVNLSF----------------LSRIEFRNNRLRQVQLHVFAGTMAL 197
            ..:..:|    .||    |.||||                |........||..::.:.|.|...|
Zfish   275 CNLTAVPYVAIQHLVYLRFFNLSFNPIEVVEGNKMHNLLRLQAFHLVGGRLVSIEPYSFKGLNYL 339

  Fly   198 SAISLEQNRLSHLHKETFKDLQKLMHLSLQGNAWNCSCELQDF--RDFAISKRLYTPPTDCQEPP 260
            ..:::..|.||.|.:..|..:..|..|:|..|...|.|.|...  |.:.::.....|  .|:.|.
Zfish   340 RVLNVSSNSLSTLEESAFHSVGNLETLALHDNPLACDCRLLWVFRRRWRLNFNRQQP--SCETPE 402

  Fly   261 QLRGKLWSE----VPSENFACRP---RILGSVRSFIEANHDNISLPCRIVGSPRPNVTWVYNKRP 318
            .|:||.:.:    :|...|.|:.   |...::..|::.. ..:..||:..|.|.|.:.|      
Zfish   403 FLQGKEFKDFPDVLPPNYFTCQKSKIRDHKAIHRFVDEG-TTVQFPCQADGDPTPMIMW------ 460

  Fly   319 LQQYDPRVRVLT--SVEQMPEQPSQVLTSELRIVGVRASDKGAYTCVADNRGGRAEAEFQLLVSG 381
               ..|:.:.:|  |:.::    |..|...|.:...:..|.|.|||.|.|.||. :.....|...
Zfish   461 ---QSPKKQFITTKSIGRL----SVSLDGTLEVRYAQIQDNGTYTCFAVNAGGN-DTRLAHLHVH 517

  Fly   382 DYA---------------GAVSASDGMGMGAIGAPTIDPQTNMFLIICLIITTLLLLLLVAVLTL 431
            .|:               ...|.:...|.||:.....|.:|.:.......|:.|.::|...||..
Zfish   518 SYSPNWPHQPNKTFAFILNQPSDNSANGTGAMDPFPFDMKTLIIATTMGFISFLGVVLFCLVLLF 582

  Fly   432 FW 433
            .|
Zfish   583 LW 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek5NP_001245746.1 LRR_RI <76..160 CDD:238064 34/201 (17%)
leucine-rich repeat 76..100 CDD:275380 8/45 (18%)
LRR_8 99..159 CDD:290566 26/155 (17%)
leucine-rich repeat 101..124 CDD:275380 6/22 (27%)
LRR 122..145 CDD:197688 11/46 (24%)
leucine-rich repeat 125..148 CDD:275380 12/75 (16%)
LRR_8 148..207 CDD:290566 23/125 (18%)
leucine-rich repeat 149..172 CDD:275380 13/73 (18%)
leucine-rich repeat 173..196 CDD:275380 5/22 (23%)
LRR_8 197..>229 CDD:290566 9/31 (29%)
leucine-rich repeat 197..220 CDD:275380 6/22 (27%)
LRRCT 229..277 CDD:214507 13/53 (25%)
Ig 296..376 CDD:143165 21/81 (26%)
lingo1bNP_001004576.1 LRRNT 43..77 CDD:214470 6/46 (13%)
LRR 1 74..95 6/20 (30%)
leucine-rich repeat 75..98 CDD:275380 7/22 (32%)
LRR_8 76..133 CDD:290566 11/56 (20%)
LRR_RI 78..>315 CDD:238064 42/236 (18%)
LRR 2 98..119 0/20 (0%)
leucine-rich repeat 99..146 CDD:275380 7/46 (15%)
LRR 3 122..143 4/20 (20%)
LRR_8 130..181 CDD:290566 13/50 (26%)
LRR 4 146..167 6/20 (30%)
leucine-rich repeat 147..170 CDD:275380 6/22 (27%)
LRR_8 170..226 CDD:290566 8/55 (15%)
LRR 5 170..191 4/20 (20%)
leucine-rich repeat 171..194 CDD:275380 6/22 (27%)
LRR 6 194..215 0/20 (0%)
leucine-rich repeat 195..218 CDD:275380 0/22 (0%)
LRR 7 218..239 6/20 (30%)
leucine-rich repeat 219..242 CDD:275380 6/22 (27%)
leucine-rich repeat 243..290 CDD:275380 5/46 (11%)
LRR_8 266..325 CDD:290566 11/58 (19%)
LRR 8 266..287 3/20 (15%)
LRR 9 290..311 5/20 (25%)
leucine-rich repeat 291..338 CDD:275380 10/46 (22%)
LRR_8 314..373 CDD:290566 15/58 (26%)
LRR 10 314..335 4/20 (20%)
LRR 11 338..359 6/20 (30%)
leucine-rich repeat 339..362 CDD:275380 6/22 (27%)
TPKR_C2 371..424 CDD:301599 13/54 (24%)
IG_like 438..516 CDD:214653 22/92 (24%)
Ig 441..516 CDD:299845 22/89 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I12360
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8422
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.