Sequence 1: | NP_001245746.1 | Gene: | kek5 / 32930 | FlyBaseID: | FBgn0031016 | Length: | 931 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_650952.2 | Gene: | CG5810 / 42513 | FlyBaseID: | FBgn0038866 | Length: | 428 | Species: | Drosophila melanogaster |
Alignment Length: | 273 | Identity: | 71/273 - (26%) |
---|---|---|---|
Similarity: | 121/273 - (44%) | Gaps: | 56/273 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 SADCKNKALTKIPQDMSNEMQVLDFAHNQIPELRREEFL------LAGLPNVHKIFLR------- 107
Fly 108 ---NCTIQEVHREAFKGLHILIELDLSGNRIRELHPGTFAGLEKLRNVIINNNEIEVLPNHLFVN 169
Fly 170 LSFLSRIEFRNNRLRQVQLHVFAGTMALSAISLEQNRLSHLHKETFKDLQKLMHLSLQGNAWNCS 234
Fly 235 CELQDFRDF-AISKRLYTPPTDCQEPPQLRGKLWSEVPSENFACRPRI----LGSVRSFIEANH- 293
Fly 294 --DNISLPCRIVG 304 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek5 | NP_001245746.1 | LRR_RI | <76..160 | CDD:238064 | 29/99 (29%) |
leucine-rich repeat | 76..100 | CDD:275380 | 10/29 (34%) | ||
LRR_8 | 99..159 | CDD:290566 | 19/69 (28%) | ||
leucine-rich repeat | 101..124 | CDD:275380 | 8/32 (25%) | ||
LRR | 122..145 | CDD:197688 | 8/22 (36%) | ||
leucine-rich repeat | 125..148 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 148..207 | CDD:290566 | 18/58 (31%) | ||
leucine-rich repeat | 149..172 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 173..196 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 197..>229 | CDD:290566 | 12/31 (39%) | ||
leucine-rich repeat | 197..220 | CDD:275380 | 8/22 (36%) | ||
LRRCT | 229..277 | CDD:214507 | 6/48 (13%) | ||
Ig | 296..376 | CDD:143165 | 3/9 (33%) | ||
CG5810 | NP_650952.2 | leucine-rich repeat | 65..88 | CDD:275380 | 10/24 (42%) |
LRR_8 | 87..147 | CDD:290566 | 14/59 (24%) | ||
leucine-rich repeat | 89..112 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 113..136 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 135..195 | CDD:290566 | 18/59 (31%) | ||
LRR_4 | 135..175 | CDD:289563 | 13/39 (33%) | ||
leucine-rich repeat | 137..160 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 161..184 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 185..209 | CDD:275380 | 9/25 (36%) | ||
leucine-rich repeat | 210..231 | CDD:275380 | 7/46 (15%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45453621 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |