| Sequence 1: | NP_001245746.1 | Gene: | kek5 / 32930 | FlyBaseID: | FBgn0031016 | Length: | 931 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_005573.2 | Gene: | CD180 / 4064 | HGNCID: | 6726 | Length: | 661 | Species: | Homo sapiens |
| Alignment Length: | 391 | Identity: | 78/391 - (19%) |
|---|---|---|---|
| Similarity: | 148/391 - (37%) | Gaps: | 97/391 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 37 TDWMQSCGTCHCQWNSGKKSADCKNKALTKIPQDMSNEMQVLDFAHNQIPELRREEFLLAGLPNV 101
Fly 102 HKIFLRNCTIQEVHREAFKGLHILIELDLSGNRIRELHPGTFAGLEKLRNVII---NNNEIEVLP 163
Fly 164 NHLFVNLSFLSRIEFRNNRLRQVQLHVFAGTMALSAISLEQNRLSHLHKETFKDLQKLMHLSLQG 228
Fly 229 NAWNC-------------------------------------SCELQDFRDF-------AISKRL 249
Fly 250 YTPPTDCQ---EPPQLRGKLWSEVPSENFACRPRI-------------------LGSVRSFI-EA 291
Fly 292 NH-DNISLPCRIVGSPRPNVTWVYNKRPLQQYDPRVRVLTSVEQMPEQPSQVLTSELRIVGVRAS 355
Fly 356 D 356 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek5 | NP_001245746.1 | LRR_RI | <76..160 | CDD:238064 | 20/86 (23%) |
| leucine-rich repeat | 76..100 | CDD:275380 | 6/23 (26%) | ||
| LRR_8 | 99..159 | CDD:290566 | 14/62 (23%) | ||
| leucine-rich repeat | 101..124 | CDD:275380 | 5/22 (23%) | ||
| LRR | 122..145 | CDD:197688 | 6/22 (27%) | ||
| leucine-rich repeat | 125..148 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 148..207 | CDD:290566 | 10/61 (16%) | ||
| leucine-rich repeat | 149..172 | CDD:275380 | 6/25 (24%) | ||
| leucine-rich repeat | 173..196 | CDD:275380 | 2/22 (9%) | ||
| LRR_8 | 197..>229 | CDD:290566 | 7/31 (23%) | ||
| leucine-rich repeat | 197..220 | CDD:275380 | 4/22 (18%) | ||
| LRRCT | 229..277 | CDD:214507 | 15/94 (16%) | ||
| Ig | 296..376 | CDD:143165 | 13/61 (21%) | ||
| CD180 | NP_005573.2 | leucine-rich repeat | 38..57 | CDD:275380 | 6/18 (33%) |
| LRR 1 | 54..75 | 5/22 (23%) | |||
| leucine-rich repeat | 58..78 | CDD:275380 | 6/21 (29%) | ||
| LRR 2 | 78..99 | 6/20 (30%) | |||
| leucine-rich repeat | 79..102 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 102..161 | CDD:290566 | 14/61 (23%) | ||
| LRR 3 | 102..123 | 5/20 (25%) | |||
| leucine-rich repeat | 103..126 | CDD:275380 | 6/22 (27%) | ||
| LRR 4 | 126..147 | 4/23 (17%) | |||
| leucine-rich repeat | 127..150 | CDD:275380 | 6/25 (24%) | ||
| LRR 5 | 150..171 | 2/20 (10%) | |||
| leucine-rich repeat | 151..174 | CDD:275380 | 2/22 (9%) | ||
| LRR 6 | 174..195 | 3/20 (15%) | |||
| leucine-rich repeat | 175..195 | CDD:275380 | 3/19 (16%) | ||
| leucine-rich repeat | 196..234 | CDD:275380 | 6/37 (16%) | ||
| LRR 7 | 201..221 | 5/19 (26%) | |||
| leucine-rich repeat | 235..275 | CDD:275380 | 8/45 (18%) | ||
| LRR 8 | 275..296 | 5/20 (25%) | |||
| leucine-rich repeat | 276..299 | CDD:275380 | 6/22 (27%) | ||
| LRR 9 | 299..320 | 0/20 (0%) | |||
| leucine-rich repeat | 300..322 | CDD:275380 | 1/21 (5%) | ||
| LRR 10 | 322..343 | 5/23 (22%) | |||
| LRR_8 | 323..382 | CDD:290566 | 13/68 (19%) | ||
| leucine-rich repeat | 323..371 | CDD:275380 | 11/57 (19%) | ||
| LRR_RI | 327..541 | CDD:238064 | 16/70 (23%) | ||
| LRR 11 | 346..366 | 3/19 (16%) | |||
| LRR_8 | 371..432 | CDD:290566 | 5/16 (31%) | ||
| LRR 12 | 371..391 | 5/16 (31%) | |||
| leucine-rich repeat | 372..397 | CDD:275380 | 5/15 (33%) | ||
| LRR 13 | 397..418 | ||||
| leucine-rich repeat | 398..421 | CDD:275380 | |||
| LRR_8 | 420..481 | CDD:290566 | |||
| LRR 14 | 421..442 | ||||
| leucine-rich repeat | 422..446 | CDD:275380 | |||
| LRR 15 | 446..466 | ||||
| leucine-rich repeat | 447..470 | CDD:275380 | |||
| LRR 16 | 470..493 | ||||
| leucine-rich repeat | 471..497 | CDD:275380 | |||
| LRR_8 | 497..555 | CDD:290566 | |||
| LRR 17 | 497..518 | ||||
| leucine-rich repeat | 498..521 | CDD:275380 | |||
| LRR 18 | 521..544 | ||||
| leucine-rich repeat | 522..543 | CDD:275380 | |||
| LRR 19 | 546..564 | ||||
| TPKR_C2 | 577..626 | CDD:301599 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||