DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek5 and CG42709

DIOPT Version :9

Sequence 1:NP_001245746.1 Gene:kek5 / 32930 FlyBaseID:FBgn0031016 Length:931 Species:Drosophila melanogaster
Sequence 2:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster


Alignment Length:394 Identity:96/394 - (24%)
Similarity:169/394 - (42%) Gaps:73/394 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KSADCKNKALTKIPQDMSNEMQVLDFAHNQIPELRREEFLLAGLPNVHKIFLRNCTIQEVHREAF 119
            |...|.|..||.:|.||.....::|.:||.|.|||.|:|  |.|....:|.|.:..|..:.::.|
  Fly   104 KFVQCANAHLTHVPLDMPKTAAIIDLSHNVIAELRPEDF--ANLSRAVEINLNHNLISSIDKDVF 166

  Fly   120 KGLHILIELDLSGNRIRELHPGTFAGLEKLRNVIINNNEIEVLPNHLFVNLSFLSRIEFRNNRLR 184
            :|...|..|.|:.||:.::.|.|||..::|..:.::||.|....:..|:|...|  :||      
  Fly   167 QGSERLKRLRLANNRLTKIDPDTFAAAKELTLLDLSNNTITQRLDGSFLNQPDL--VEF------ 223

  Fly   185 QVQLHVFAGTMALSAISLEQNRLSHLHKETFKDLQKLMHLSLQGNAWNCSCELQDFRDFAISKRL 249
                         |.::..   .:.|.::||:::..|..|.|..|         ||:. .|:.:.
  Fly   224 -------------SCVNCS---WTELPEQTFQNMSGLEVLRLNKN---------DFKQ-QINTKA 262

  Fly   250 YTPPTDCQEPPQLRGKLWSEVPSENFACRPRILGSVRSFIEANHDNISLPCRIVGSPRPNVTWVY 314
            ::|.|..     ::.|| .|:..:|......:|.|:.:....|:| ||....::|:|       :
  Fly   263 FSPLTKI-----IKLKL-PELEQQNIEELCSLLTSIDTISFLNYD-ISCYEFVLGTP-------F 313

  Fly   315 NKRPLQQYDPRVRVLTSVEQMPEQPSQVLTSELRIVGVRASDKGAYTCVADNRG-GRAEAEFQLL 378
            |...:...:|.::.:|:    |...:.:.::...:....|..:.|      ||. |:.:...:|:
  Fly   314 NGSLIYPTEPPLKGITN----PPIVASITSTAKPVTATPAPPRSA------NRNRGKMDNSTELV 368

  Fly   379 VSGDYAGAVSASDGMGMGAIGAPTIDPQTNMFLIICLIITTLLLLLLVAV---LTLFWYCRR--- 437
            .:|..:...|.|     |....|..:.|||...|....|.|||:.::|..   :.:...||:   
  Fly   369 KAGILSSETSTS-----GVSVEPPAESQTNQVQISQEAINTLLICIMVLAVIGIVIGLICRQDIG 428

  Fly   438 -IKT 440
             |||
  Fly   429 GIKT 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek5NP_001245746.1 LRR_RI <76..160 CDD:238064 28/83 (34%)
leucine-rich repeat 76..100 CDD:275380 11/23 (48%)
LRR_8 99..159 CDD:290566 17/59 (29%)
leucine-rich repeat 101..124 CDD:275380 5/22 (23%)
LRR 122..145 CDD:197688 8/22 (36%)
leucine-rich repeat 125..148 CDD:275380 9/22 (41%)
LRR_8 148..207 CDD:290566 10/58 (17%)
leucine-rich repeat 149..172 CDD:275380 6/22 (27%)
leucine-rich repeat 173..196 CDD:275380 3/22 (14%)
LRR_8 197..>229 CDD:290566 7/31 (23%)
leucine-rich repeat 197..220 CDD:275380 4/22 (18%)
LRRCT 229..277 CDD:214507 10/47 (21%)
Ig 296..376 CDD:143165 13/80 (16%)
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 20/57 (35%)
leucine-rich repeat 128..147 CDD:275380 11/20 (55%)
leucine-rich repeat 148..171 CDD:275380 5/22 (23%)
LRR_RI <150..225 CDD:238064 23/95 (24%)
LRR_8 171..254 CDD:290566 26/115 (23%)
leucine-rich repeat 172..195 CDD:275380 9/22 (41%)
leucine-rich repeat 196..219 CDD:275380 6/22 (27%)
leucine-rich repeat 220..243 CDD:275380 7/46 (15%)
leucine-rich repeat 244..268 CDD:275380 8/33 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453717
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.