Sequence 1: | NP_001245746.1 | Gene: | kek5 / 32930 | FlyBaseID: | FBgn0031016 | Length: | 931 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001013675.1 | Gene: | LRRC26 / 389816 | HGNCID: | 31409 | Length: | 334 | Species: | Homo sapiens |
Alignment Length: | 233 | Identity: | 69/233 - (29%) |
---|---|---|---|
Similarity: | 96/233 - (41%) | Gaps: | 37/233 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 RRLGMILLLLG-----VLVVLMALPPPTAGTTDWMQSCGTCHCQWNSGKKSADCKNKALTKIPQD 70
Fly 71 MSNEMQVLDFAHNQIPELRREEFLLAGLPNVHKIFLRNCTIQEVHREAFKGLHILIELDLSGNRI 135
Fly 136 RELHPGTFAGLEKLRNVIINNNEIEVLPNHLFVNLSFLSRIEFRNNRLRQVQLHVFAGTMALSAI 200
Fly 201 SLEQNRLSHLHKETFKDLQKLMHLSLQGNAWNCSCELQ 238 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek5 | NP_001245746.1 | LRR_RI | <76..160 | CDD:238064 | 31/83 (37%) |
leucine-rich repeat | 76..100 | CDD:275380 | 7/23 (30%) | ||
LRR_8 | 99..159 | CDD:290566 | 24/59 (41%) | ||
leucine-rich repeat | 101..124 | CDD:275380 | 8/22 (36%) | ||
LRR | 122..145 | CDD:197688 | 12/22 (55%) | ||
leucine-rich repeat | 125..148 | CDD:275380 | 13/22 (59%) | ||
LRR_8 | 148..207 | CDD:290566 | 10/58 (17%) | ||
leucine-rich repeat | 149..172 | CDD:275380 | 3/22 (14%) | ||
leucine-rich repeat | 173..196 | CDD:275380 | 3/22 (14%) | ||
LRR_8 | 197..>229 | CDD:290566 | 10/31 (32%) | ||
leucine-rich repeat | 197..220 | CDD:275380 | 7/22 (32%) | ||
LRRCT | 229..277 | CDD:214507 | 5/10 (50%) | ||
Ig | 296..376 | CDD:143165 | |||
LRRC26 | NP_001013675.1 | LRR 1 | 72..93 | 5/22 (23%) | |
LRR 2 | 96..117 | 6/20 (30%) | |||
LRR_RI | 97..>253 | CDD:238064 | 43/138 (31%) | ||
LRR_8 | 97..155 | CDD:290566 | 25/81 (31%) | ||
leucine-rich repeat | 97..120 | CDD:275380 | 8/22 (36%) | ||
LRR 3 | 120..141 | 11/20 (55%) | |||
leucine-rich repeat | 121..144 | CDD:275380 | 13/22 (59%) | ||
LRR_8 | 143..202 | CDD:290566 | 17/82 (21%) | ||
LRR 4 | 144..167 | 6/46 (13%) | |||
leucine-rich repeat | 145..168 | CDD:275380 | 6/46 (13%) | ||
LRR 5 | 168..190 | 6/21 (29%) | |||
leucine-rich repeat | 169..192 | CDD:275380 | 7/22 (32%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 298..334 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |