DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek5 and ISLR

DIOPT Version :9

Sequence 1:NP_001245746.1 Gene:kek5 / 32930 FlyBaseID:FBgn0031016 Length:931 Species:Drosophila melanogaster
Sequence 2:NP_005536.1 Gene:ISLR / 3671 HGNCID:6133 Length:428 Species:Homo sapiens


Alignment Length:426 Identity:102/426 - (23%)
Similarity:164/426 - (38%) Gaps:79/426 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLLGVLVVLMALPPPTAGTTDWMQSCGTCHCQWNSGKKSADCKNKALTKIPQDMSNEMQVLDFAH 82
            ||||   :..|.|.|             |.|....|.:.|||..:.|..:|......:..|..:.
Human    11 LLLG---LAQACPEP-------------CDCGEKYGFQIADCAYRDLESVPPGFPANVTTLSLSA 59

  Fly    83 NQIPELRREEFLLAGLPNVHKIFLRNCTIQEVHREAFKGLHILIELDLSGNRIRELHPGTFAGLE 147
            |::|          |||                ..||:.:.:|..|.|:.|.||.:..|..|.|.
Human    60 NRLP----------GLP----------------EGAFREVPLLQSLWLAHNEIRTVAAGALASLS 98

  Fly   148 KLRNVIINNNEIEVLPNHLFVNLSFLSRIEFRNNRLRQVQLHVFAGTMALSAISLEQNRLSHLHK 212
            .|:::.:::|.|.........|||.|..::..:|.|..:....|....||.::.|..|||..|.:
Human    99 HLKSLDLSHNLISDFAWSDLHNLSALQLLKMDSNELTFIPRDAFRSLRALRSLQLNHNRLHTLAE 163

  Fly   213 ETFKDLQKLMHLSLQGNAWNCSCELQDFRDFAISKRLYTPPTD---CQEPPQLRGKLWSEVPSEN 274
            .||..|..|.||.:..|.::|:|.:...:.:|::..:..|..|   |..|..|:|...|.:|.  
Human   164 GTFTPLTALSHLQINENPFDCTCGIVWLKTWALTTAVSIPEQDNIACTSPHVLKGTPLSRLPP-- 226

  Fly   275 FACRPRILGSVRSFIEANHDN--------ISLPCRIVGSPRPNVTWVYNKRP---LQQYDPRV-- 326
               .|....||:...:.:.|.        ::|.|.:.|.|.|.:.| :.:.|   ::...|.|  
Human   227 ---LPCSAPSVQLSYQPSQDGAELRPGFVLALHCDVDGQPAPQLHW-HIQIPSGIVEITSPNVGT 287

  Fly   327 --RVLTSVEQMPEQP--SQVLTSELRIVGVRASDKGAYTCVADNRGGRAEAEFQLLVSGDYAGAV 387
              |.|........||  .......|.|......::|.|:|:|.|..|.||:...:.::....|..
Human   288 DGRALPGTPVASSQPRFQAFANGSLLIPDFGKLEEGTYSCLATNELGSAESSVDVALATPGEGGE 352

  Fly   388 SA----SDGMGMGAIGAPTID-------PQTNMFLI 412
            ..    ..|..:...|..|:|       |:.|:.:|
Human   353 DTLGRRFHGKAVEGKGCYTVDNEVQPSGPEDNVVII 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek5NP_001245746.1 LRR_RI <76..160 CDD:238064 19/83 (23%)
leucine-rich repeat 76..100 CDD:275380 5/23 (22%)
LRR_8 99..159 CDD:290566 14/59 (24%)
leucine-rich repeat 101..124 CDD:275380 2/22 (9%)
LRR 122..145 CDD:197688 7/22 (32%)
leucine-rich repeat 125..148 CDD:275380 9/22 (41%)
LRR_8 148..207 CDD:290566 14/58 (24%)
leucine-rich repeat 149..172 CDD:275380 5/22 (23%)
leucine-rich repeat 173..196 CDD:275380 4/22 (18%)
LRR_8 197..>229 CDD:290566 12/31 (39%)
leucine-rich repeat 197..220 CDD:275380 9/22 (41%)
LRRCT 229..277 CDD:214507 12/50 (24%)
Ig 296..376 CDD:143165 23/88 (26%)
ISLRNP_005536.1 leucine-rich repeat 32..51 CDD:275380 5/18 (28%)
LRR_8 51..110 CDD:316378 19/84 (23%)
LRR 1 51..72 8/46 (17%)
leucine-rich repeat 52..75 CDD:275380 8/48 (17%)
LRR 2 75..96 7/20 (35%)
leucine-rich repeat 76..99 CDD:275380 9/22 (41%)
LRR_8 98..158 CDD:316378 14/59 (24%)
LRR 3 99..122 4/22 (18%)
leucine-rich repeat 100..123 CDD:275380 5/22 (23%)
LRR 4 123..144 4/20 (20%)
leucine-rich repeat 124..147 CDD:275380 4/22 (18%)
LRR 5 147..168 9/20 (45%)
leucine-rich repeat 148..171 CDD:275380 9/22 (41%)
PCC 153..>227 CDD:188093 23/78 (29%)
I-set 239..340 CDD:333254 24/101 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.