DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek5 and CG18480

DIOPT Version :9

Sequence 1:NP_001245746.1 Gene:kek5 / 32930 FlyBaseID:FBgn0031016 Length:931 Species:Drosophila melanogaster
Sequence 2:NP_001285960.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster


Alignment Length:331 Identity:72/331 - (21%)
Similarity:131/331 - (39%) Gaps:47/331 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LGMILLLLGVLVVLMALPPPTAGTTDWMQSCGT-CHCQWNSGKKSADCKNKALTKIPQDMSNEMQ 76
            ||:..:||.|.::|..|.......|.....|.| |||..::.:..|.|..|.|.....::...::
  Fly    13 LGLKQILLYVGLLLCVLLQVCRSKTQSQMFCPTVCHCDLHAQRNRAVCSAKRLISANIEIPTTVE 77

  Fly    77 VLDFAHNQIPELRREEFLLAGLPNVH--KIFLRNCTIQEVHREAFKGLHILIELDLSGNRIRELH 139
            :||.::|.|..:..:.|    ...:|  .:.|.:..|..::.:||..|..|..||||.||:.::.
  Fly    78 LLDLSYNDITTIDDDSF----KTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQID 138

  Fly   140 PGTFAGLEKLRNVIINNNEIEVLPNHLFVNLSFLSRIEFRNNRLRQVQLHVFAGTMALSAISLEQ 204
            ........:|.::.:..|::..|.....:....|..:..||:::.|:...:.:....|..:.|.|
  Fly   139 EHILESNNQLIHLNLEGNKLSTLGKGPILRSPSLRSLNLRNSQVNQLGTQLLSALPQLRQLDLAQ 203

  Fly   205 NRLSHLHKETFKDLQKLMHLSLQGNAWNC---------------------SC---ELQDFRDFA- 244
            |.|..|....|...:.|..|:::.|.:||                     :|   |:||.:|.| 
  Fly   204 NLLLTLSPGDFHAPRNLASLNVEENPFNCDRALAKVATGLRQRGVAIFMSNCMEEEVQDHQDDAE 268

  Fly   245 ----------ISKRLYTPPTDCQEPPQLRGKLWSEVPS---ENFACRPRILGSVRSFIEANHDNI 296
                      .....|..|:  ...||....:|.::.|   :|.:.....:.|:....|.:.:.:
  Fly   269 AVNFPNKNEKFESMEYLEPS--TRGPQSVLSVWRDLDSSEEQNSSQDDEQMSSLSDVCEGSREKL 331

  Fly   297 SLPCRI 302
            .|..||
  Fly   332 CLRYRI 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek5NP_001245746.1 LRR_RI <76..160 CDD:238064 20/85 (24%)
leucine-rich repeat 76..100 CDD:275380 5/23 (22%)
LRR_8 99..159 CDD:290566 15/61 (25%)
leucine-rich repeat 101..124 CDD:275380 6/24 (25%)
LRR 122..145 CDD:197688 8/22 (36%)
leucine-rich repeat 125..148 CDD:275380 7/22 (32%)
LRR_8 148..207 CDD:290566 11/58 (19%)
leucine-rich repeat 149..172 CDD:275380 3/22 (14%)
leucine-rich repeat 173..196 CDD:275380 4/22 (18%)
LRR_8 197..>229 CDD:290566 9/31 (29%)
leucine-rich repeat 197..220 CDD:275380 7/22 (32%)
LRRCT 229..277 CDD:214507 16/85 (19%)
Ig 296..376 CDD:143165 3/7 (43%)
CG18480NP_001285960.1 LRR_8 74..134 CDD:290566 17/63 (27%)
LRR_RI <76..230 CDD:238064 35/157 (22%)
leucine-rich repeat 76..99 CDD:275380 5/26 (19%)
leucine-rich repeat 100..123 CDD:275380 5/22 (23%)
LRR_8 122..182 CDD:290566 13/59 (22%)
leucine-rich repeat 124..147 CDD:275380 7/22 (32%)
leucine-rich repeat 148..171 CDD:275380 3/22 (14%)
LRR_8 170..230 CDD:290566 14/59 (24%)
leucine-rich repeat 172..195 CDD:275380 4/22 (18%)
leucine-rich repeat 196..219 CDD:275380 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453722
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.