DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek5 and Toll-4

DIOPT Version :9

Sequence 1:NP_001245746.1 Gene:kek5 / 32930 FlyBaseID:FBgn0031016 Length:931 Species:Drosophila melanogaster
Sequence 2:NP_523519.2 Gene:Toll-4 / 34235 FlyBaseID:FBgn0032095 Length:1125 Species:Drosophila melanogaster


Alignment Length:301 Identity:69/301 - (22%)
Similarity:107/301 - (35%) Gaps:114/301 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 CHC--QWNSGKKSADCKNKALTKIPQDMSNEM---QVLDFAHNQIPEL-RREEFLLAGLPNVHKI 104
            |.|  :|::|:...:|:|.:|...|: :.|.:   ..|....|:|.:| ..|..::||..::||:
  Fly   598 CSCCFEWHTGEFLINCRNLSLDIYPR-LPNSIPYKTTLYLDRNEIRKLTNTESLVVAGHASIHKL 661

  Fly   105 FLRNCTIQEVHREAFKGLHILIE----LDLSGNRIRELHPGTFAGLEKLRNVIINNNEIEVLPNH 165
            .:....::|:      .||:|.|    ||:..|.::.|..|..|.||...|:    .:||:..|.
  Fly   662 HMSQNLLREL------PLHLLPENITYLDVRNNLLKYLDDGVIAFLEYRENI----TKIELSGNP 716

  Fly   166 LFVN------LSFLSRIE----------------------------------------------- 177
            ...|      ||||.|.|                                               
  Fly   717 WECNCKAKAFLSFLRRHEPMEYETVLRRVEITDDKCPEDCICCVDTSNSDSLAYVVDCSGKELSE 781

  Fly   178 ---------------FRNNRLRQVQLHVFAGTMALSAISLEQNRLSHL----HKETFKD------ 217
                           |..|.|::....:..|..:::...|..||||.:    .|..:.|      
  Fly   782 IPQLPTPTYGQTTLVFERNSLKKWPSSLLPGYSSVTRFYLAHNRLSDIDQLPDKLEYLDISNNNF 846

  Fly   218 ----------LQKLMH-----LSLQGNAWNCSCELQDFRDF 243
                      |||.|:     |||.||.|.|.||.:||..|
  Fly   847 SALDDRVRGFLQKRMNSSQLQLSLFGNPWTCRCEDKDFLVF 887

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek5NP_001245746.1 LRR_RI <76..160 CDD:238064 23/88 (26%)
leucine-rich repeat 76..100 CDD:275380 7/24 (29%)
LRR_8 99..159 CDD:290566 16/63 (25%)
leucine-rich repeat 101..124 CDD:275380 4/22 (18%)
LRR 122..145 CDD:197688 9/26 (35%)
leucine-rich repeat 125..148 CDD:275380 9/26 (35%)
LRR_8 148..207 CDD:290566 17/126 (13%)
leucine-rich repeat 149..172 CDD:275380 6/28 (21%)
leucine-rich repeat 173..196 CDD:275380 7/84 (8%)
LRR_8 197..>229 CDD:290566 14/56 (25%)
leucine-rich repeat 197..220 CDD:275380 8/42 (19%)
LRRCT 229..277 CDD:214507 8/15 (53%)
Ig 296..376 CDD:143165
Toll-4NP_523519.2 leucine-rich repeat 264..287 CDD:275380
leucine-rich repeat 288..308 CDD:275380
leucine-rich repeat 309..334 CDD:275380
leucine-rich repeat 335..386 CDD:275380
leucine-rich repeat 388..408 CDD:275380
LRR_8 412..465 CDD:290566
leucine-rich repeat 412..432 CDD:275378
LRR_4 432..470 CDD:289563
leucine-rich repeat 433..454 CDD:275378
leucine-rich repeat 455..478 CDD:275378
leucine-rich repeat 479..490 CDD:275378
leucine-rich repeat 632..657 CDD:275378 7/24 (29%)
leucine-rich repeat 658..679 CDD:275378 6/26 (23%)
leucine-rich repeat 680..706 CDD:275378 8/25 (32%)
leucine-rich repeat 707..719 CDD:275378 3/15 (20%)
leucine-rich repeat 771..791 CDD:275380 0/19 (0%)
leucine-rich repeat 793..815 CDD:275378 4/21 (19%)
leucine-rich repeat 816..835 CDD:275378 5/18 (28%)
leucine-rich repeat 836..859 CDD:275378 2/22 (9%)
TIR 974..1110 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453718
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.