DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek5 and AgaP_AGAP011373

DIOPT Version :9

Sequence 1:NP_001245746.1 Gene:kek5 / 32930 FlyBaseID:FBgn0031016 Length:931 Species:Drosophila melanogaster
Sequence 2:XP_554872.3 Gene:AgaP_AGAP011373 / 3291302 VectorBaseID:AGAP011373 Length:240 Species:Anopheles gambiae


Alignment Length:152 Identity:47/152 - (30%)
Similarity:77/152 - (50%) Gaps:2/152 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LDFAHNQIPELRREEFLLAGLPNVHKIFLRNCTIQEVHREAFKGLHILIELDLSGNRIRELHPGT 142
            |...:|:|..:..:.|  ||:..:..:.||...|::|.:..|:.|..|.||:|..|:|..|||..
Mosquito    29 LHLNNNKIASIGNKTF--AGMDELRVLNLRGNFIEQVTKGLFRALPKLEELNLGENQIATLHPEA 91

  Fly   143 FAGLEKLRNVIINNNEIEVLPNHLFVNLSFLSRIEFRNNRLRQVQLHVFAGTMALSAISLEQNRL 207
            |.||..||.:.:::|.|.|:|...|..|..|:.:....|.|.|:|...|.|...|..:.:..:.|
Mosquito    92 FEGLPYLRILHLDDNAINVIPTPSFTPLRLLAELYLGLNTLNQIQPGSFEGLQHLRRLDVRGSML 156

  Fly   208 SHLHKETFKDLQKLMHLSLQGN 229
            .:|..:||:.|:.:..|.:..|
Mosquito   157 VNLTIDTFRGLENVRSLDISDN 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek5NP_001245746.1 LRR_RI <76..160 CDD:238064 27/81 (33%)
leucine-rich repeat 76..100 CDD:275380 6/21 (29%)
LRR_8 99..159 CDD:290566 21/59 (36%)
leucine-rich repeat 101..124 CDD:275380 6/22 (27%)
LRR 122..145 CDD:197688 11/22 (50%)
leucine-rich repeat 125..148 CDD:275380 12/22 (55%)
LRR_8 148..207 CDD:290566 16/58 (28%)
leucine-rich repeat 149..172 CDD:275380 8/22 (36%)
leucine-rich repeat 173..196 CDD:275380 7/22 (32%)
LRR_8 197..>229 CDD:290566 7/31 (23%)
leucine-rich repeat 197..220 CDD:275380 6/22 (27%)
LRRCT 229..277 CDD:214507 1/1 (100%)
Ig 296..376 CDD:143165
AgaP_AGAP011373XP_554872.3 LRR_RI <2..>150 CDD:238064 40/122 (33%)
LRR_8 2..58 CDD:290566 8/30 (27%)
leucine-rich repeat 2..25 CDD:275380
leucine-rich repeat 26..49 CDD:275380 6/21 (29%)
LRR_8 49..108 CDD:290566 21/58 (36%)
leucine-rich repeat 50..73 CDD:275380 6/22 (27%)
leucine-rich repeat 74..97 CDD:275380 12/22 (55%)
leucine-rich repeat 98..121 CDD:275380 8/22 (36%)
LRR_8 120..180 CDD:290566 15/59 (25%)
leucine-rich repeat 122..145 CDD:275380 7/22 (32%)
leucine-rich repeat 146..169 CDD:275380 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.