DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek5 and slitrk6

DIOPT Version :9

Sequence 1:NP_001245746.1 Gene:kek5 / 32930 FlyBaseID:FBgn0031016 Length:931 Species:Drosophila melanogaster
Sequence 2:NP_001292482.1 Gene:slitrk6 / 324096 ZFINID:ZDB-GENE-030131-2816 Length:830 Species:Danio rerio


Alignment Length:338 Identity:76/338 - (22%)
Similarity:125/338 - (36%) Gaps:96/338 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GTTDWMQSCG-----TCHCQWNSGKKSADCKNKALT-----KIPQDMSNEMQVLDFAHNQIPELR 89
            |.|:...|.|     .|.|:...|....:|:.:.::     |:|.|:...   |:...|.:.||.
Zfish    26 GDTESKASYGGACKSLCTCEEKDGVLYVNCEERNISRISDVKVPSDVPFH---LNLYKNDLVELL 87

  Fly    90 REEFLLAGLPNVHKIFLRNCTIQEVHREAFKGLHILIELDLSGNRIRELHPGTFAGLEKLRNVII 154
            .|:.                       ||||.   .|.|.|..|.|:||.||.|:.|..|:.:.|
Zfish    88 AEDV-----------------------EAFKN---AITLHLGANSIQELEPGVFSALGSLKKLHI 126

  Fly   155 NNNEIEVLPNHLFVNLSFLSRIEFRNNRLRQVQLHVFAGTMALSAISLEQNRLSHLHKETFK--- 216
            |:|.:.:|....|..|..|..::...|.:|.|:...|:..:.|..:.|..|.:..|....|:   
Zfish   127 NSNFLVMLKEDTFQGLVNLEYLQADTNFIRVVEPGAFSKLIRLKVLILNDNSIDFLPSNIFRFVP 191

  Fly   217 ----DLQ-----------------KLMHLSLQGNAWNCSCELQDFRDFAISKRLYTPPTD--CQE 258
                ||:                 ::|.|.|:.|.|.|:||:...:.:..:.|..:...:  |.:
Zfish   192 LTHLDLRGNKLQTLPYVGFLEHIGRIMELLLEDNDWVCNCEILHLKVWIENMRAQSSIGEVVCNK 256

  Fly   259 PPQLRGKLWSEVPSENFACRPRILGSVRSFIEANHDNISLPCRIVGSPRPNVTWVYNKRPLQQYD 323
            |..|:|...:.|..::..              .:|.:|:|                 :.|||..|
Zfish   257 PENLKGTSLARVKRDSLC--------------PSHADINL-----------------EEPLQSQD 290

  Fly   324 PRVRVLTSVEQMP 336
            ..|...|.|.|:|
Zfish   291 MVVTPSTKVVQIP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek5NP_001245746.1 LRR_RI <76..160 CDD:238064 24/83 (29%)
leucine-rich repeat 76..100 CDD:275380 5/23 (22%)
LRR_8 99..159 CDD:290566 19/59 (32%)
leucine-rich repeat 101..124 CDD:275380 4/22 (18%)
LRR 122..145 CDD:197688 10/22 (45%)
leucine-rich repeat 125..148 CDD:275380 11/22 (50%)
LRR_8 148..207 CDD:290566 15/58 (26%)
leucine-rich repeat 149..172 CDD:275380 7/22 (32%)
leucine-rich repeat 173..196 CDD:275380 5/22 (23%)
LRR_8 197..>229 CDD:290566 10/55 (18%)
leucine-rich repeat 197..220 CDD:275380 7/46 (15%)
LRRCT 229..277 CDD:214507 11/49 (22%)
Ig 296..376 CDD:143165 11/41 (27%)
slitrk6NP_001292482.1 leucine-rich repeat 75..96 CDD:275380 8/46 (17%)
LRR_8 76..129 CDD:290566 23/78 (29%)
leucine-rich repeat 97..120 CDD:275380 11/22 (50%)
LRR_8 120..179 CDD:290566 15/58 (26%)
leucine-rich repeat 121..144 CDD:275380 7/22 (32%)
leucine-rich repeat 145..168 CDD:275380 5/22 (23%)
LRR_8 168..226 CDD:290566 10/57 (18%)
leucine-rich repeat 169..189 CDD:275380 5/19 (26%)
leucine-rich repeat 192..281 CDD:275380 17/102 (17%)
leucine-rich repeat 217..229 CDD:275378 5/11 (45%)
TPKR_C2 225..>262 CDD:301599 9/36 (25%)
leucine-rich repeat 282..379 CDD:275380 10/39 (26%)
LRR_8 379..438 CDD:290566
LRR_4 380..419 CDD:289563
leucine-rich repeat 380..403 CDD:275380
LRR_4 403..443 CDD:289563
leucine-rich repeat 404..427 CDD:275380
leucine-rich repeat 428..446 CDD:275380
leucine-rich repeat 475..499 CDD:275380
TPKR_C2 508..>544 CDD:301599
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.