DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek5 and Cpn2

DIOPT Version :9

Sequence 1:NP_001245746.1 Gene:kek5 / 32930 FlyBaseID:FBgn0031016 Length:931 Species:Drosophila melanogaster
Sequence 2:NP_001100555.1 Gene:Cpn2 / 303861 RGDID:1305170 Length:565 Species:Rattus norvegicus


Alignment Length:370 Identity:90/370 - (24%)
Similarity:140/370 - (37%) Gaps:102/370 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LTKIPQDM---SNEMQVLDFAHNQIPELRREEFLLAGLPNVHKIFLRNCTIQEV----------- 114
            ||::|:.|   .:.:|:|..:.|....|  .|.:|:.|.::.::||.:..|.|:           
  Rat   204 LTQLPKGMFQSLSSLQILKLSDNMFARL--PEGVLSNLGSLQELFLDSNAITELSPHLFSHLLSL 266

  Fly   115 ------HR-------EAFKGLHILIELDLSGNRIRELHPGTFAGLEKLRNVIINNNEIEVLPNHL 166
                  |.       .||..|..|..|:|..|.:|.|..|.|.....|.::.::.|::|.:|...
  Rat   267 EKLWLQHNAISHLPVSAFSSLRNLTFLNLKDNALRTLPAGLFTHNPGLLHLSLSYNQLETVPEGS 331

  Fly   167 FVNLSFLSRIEFRNNRLRQVQLHVFAGTMALSAISLEQNRLSHLHKETFKDLQK----------- 220
            |.||..|:.:...:|.:..:..:||.....|..:||:.|.|:.||...|.:|.|           
  Rat   332 FANLRKLASLTLSHNAITHLPENVFRNLEQLVKLSLDSNNLTVLHPTLFHNLSKLQLLDLSRNQL 396

  Fly   221 -------------LMHLSLQGNAWNCSCELQDFRDF--AISKRLYTPPTDCQEPPQLRGKLWSEV 270
                         |.:|:|.||.|.|.|.|.....:  ..:.|::...|.|..|..|:|:|...:
  Rat   397 TMLPGGIFDTNYDLFNLALLGNPWQCDCRLSYLTSWLRLYNDRIFNTHTFCAGPAYLKGQLVPNL 461

  Fly   271 PSENFAC--RPRILG------------------SVRSFIEANHD---------------NISLPC 300
            ..|...|  .|..||                  :.|..|..|.:               ||.|..
  Rat   462 KQEQLVCPGNPGQLGLDDREPAGSWDLAVEGRAAHRQCIYGNPEGTVLLACEEAQCRWLNIQLSS 526

  Fly   301 RIVGSPRPNVT-WVYNKRPLQQYDPR-----VRVLTSVEQMPEQP 339
            | .||   :|| ..||..  |:::.|     |||..|:|.....|
  Rat   527 R-EGS---DVTAMAYNSS--QEWELRSTCGSVRVTVSIEAQAAGP 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek5NP_001245746.1 LRR_RI <76..160 CDD:238064 25/107 (23%)
leucine-rich repeat 76..100 CDD:275380 7/23 (30%)
LRR_8 99..159 CDD:290566 18/83 (22%)
leucine-rich repeat 101..124 CDD:275380 8/46 (17%)
LRR 122..145 CDD:197688 9/22 (41%)
leucine-rich repeat 125..148 CDD:275380 8/22 (36%)
LRR_8 148..207 CDD:290566 15/58 (26%)
leucine-rich repeat 149..172 CDD:275380 7/22 (32%)
leucine-rich repeat 173..196 CDD:275380 4/22 (18%)
LRR_8 197..>229 CDD:290566 13/55 (24%)
leucine-rich repeat 197..220 CDD:275380 9/22 (41%)
LRRCT 229..277 CDD:214507 13/49 (27%)
Ig 296..376 CDD:143165 17/50 (34%)
Cpn2NP_001100555.1 LRRNT 44..75 CDD:214470
leucine-rich repeat 77..97 CDD:275380
LRR_8 96..156 CDD:290566
leucine-rich repeat 122..145 CDD:275380
leucine-rich repeat 146..169 CDD:275380
LRR_8 169..226 CDD:290566 6/21 (29%)
leucine-rich repeat 170..193 CDD:275380
LRR_RI 172..418 CDD:238064 51/215 (24%)
leucine-rich repeat 194..217 CDD:275380 4/12 (33%)
leucine-rich repeat 218..241 CDD:275380 7/24 (29%)
LRR_8 241..300 CDD:290566 12/58 (21%)
leucine-rich repeat 242..265 CDD:275380 4/22 (18%)
leucine-rich repeat 266..289 CDD:275380 4/22 (18%)
LRR_8 288..348 CDD:290566 17/59 (29%)
leucine-rich repeat 290..313 CDD:275380 8/22 (36%)
leucine-rich repeat 314..337 CDD:275380 7/22 (32%)
LRR_8 336..396 CDD:290566 14/59 (24%)
leucine-rich repeat 338..361 CDD:275380 4/22 (18%)
leucine-rich repeat 362..383 CDD:275380 8/20 (40%)
leucine-rich repeat 386..405 CDD:275380 0/18 (0%)
LRRCT 418..459 CDD:214507 12/40 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.