DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek5 and Lrit1

DIOPT Version :9

Sequence 1:NP_001245746.1 Gene:kek5 / 32930 FlyBaseID:FBgn0031016 Length:931 Species:Drosophila melanogaster
Sequence 2:NP_666357.2 Gene:Lrit1 / 239037 MGIID:2385320 Length:624 Species:Mus musculus


Alignment Length:378 Identity:93/378 - (24%)
Similarity:135/378 - (35%) Gaps:60/378 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 WMQSCGTCHCQWNSGKKSADCK-------NKALTKIPQDMSNEMQVLDFAHNQIPELRREEFLLA 96
            |:.:.|..|..|........|.       :||.|.:..|..     |......||          
Mouse     9 WLLALGGPHQAWGFCPSECSCSLRILSDGSKARTVVCSDPD-----LTLPPASIP---------- 58

  Fly    97 GLPNVHKIFLRNCTIQEVHREAFKGLHILIELDLSGNRIRELHPGTFAGLEKLRNVIINNNEIEV 161
              |:..|:.|....|:.|..|.|:.|..|.:|.|..|.:.||......||.:||.:.:..|.:..
Mouse    59 --PDTCKLRLERTAIRRVPGETFRPLSRLEQLWLPYNALSELSALMLRGLRRLRELRLPGNRLVT 121

  Fly   162 LPNHLFVNLSFLSRIEFRNNRLRQVQLHVFAGTMALSAISLEQNRLSHLHKETFKDLQKL----- 221
            .|.....:...|..::.:.|||..:..........|:.:.|..|:|..|.:|.......|     
Mouse   122 FPWAALRDTPQLQLLDLQANRLSTLPPEAAHFLENLTFLDLSNNQLMRLPEELLDVWAHLKTGPF 186

  Fly   222 -------MHLSLQGNAWNCSCELQD---FRDFAISKRL--YTPPTDCQEPPQLRGKLWSEVPSEN 274
                   :.|.||.|.|.|.|.|.|   ..|..:|..|  ......|..|..|.|..:|::  |.
Mouse   187 LSGHHARLILGLQDNPWVCDCRLYDLVHLLDGWVSSNLIFIEARLRCASPRSLAGVAFSQL--EL 249

  Fly   275 FACR-PRILGSVRSFIEANHDNISLPCRIVGSPRPNVTW-VYNKRPLQQYDPRVRVLTSVEQMPE 337
            ..|: |.:...|.|.|......:.|.|...|.|.|.::| ..|.|||..        |..:::..
Mouse   250 RKCQSPELRPGVTSIISPLGSTVLLRCGATGIPGPEMSWRRANGRPLNG--------TVHQEVSS 306

  Fly   338 QPSQVLTSELRIVGVRASDKGAYTCVADNRGGRAEAEFQLLV-----SGDYAG 385
            ..|.....:|.:|.:  .|.|.|.|.|.|..|.:|....|:|     |..|:|
Mouse   307 DGSSWTLLDLPVVSL--FDSGDYICQAKNFLGASETLISLIVTEPQTSTGYSG 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek5NP_001245746.1 LRR_RI <76..160 CDD:238064 22/83 (27%)
leucine-rich repeat 76..100 CDD:275380 3/23 (13%)
LRR_8 99..159 CDD:290566 19/59 (32%)
leucine-rich repeat 101..124 CDD:275380 7/22 (32%)
LRR 122..145 CDD:197688 7/22 (32%)
leucine-rich repeat 125..148 CDD:275380 8/22 (36%)
LRR_8 148..207 CDD:290566 11/58 (19%)
leucine-rich repeat 149..172 CDD:275380 4/22 (18%)
leucine-rich repeat 173..196 CDD:275380 4/22 (18%)
LRR_8 197..>229 CDD:290566 10/43 (23%)
leucine-rich repeat 197..220 CDD:275380 6/22 (27%)
LRRCT 229..277 CDD:214507 15/52 (29%)
Ig 296..376 CDD:143165 22/80 (28%)
Lrit1NP_666357.2 LRRNT 23..61 CDD:214470 9/54 (17%)
LRR 1 60..81 6/20 (30%)
LRR_8 63..143 CDD:290566 21/79 (27%)
leucine-rich repeat 64..84 CDD:275378 6/19 (32%)
LRR 2 84..105 6/20 (30%)
leucine-rich repeat 85..132 CDD:275378 12/46 (26%)
LRR 3 108..129 4/20 (20%)
LRR_8 131..>176 CDD:290566 10/44 (23%)
LRR_4 131..172 CDD:289563 9/40 (23%)
LRR 4 132..153 4/20 (20%)
leucine-rich repeat 133..156 CDD:275378 4/22 (18%)
LRR 5 156..177 6/20 (30%)
leucine-rich repeat 157..180 CDD:275378 6/22 (27%)
leucine-rich repeat 181..205 CDD:275378 6/23 (26%)
TPKR_C2 201..>241 CDD:301599 12/39 (31%)
Ig 258..346 CDD:299845 26/97 (27%)
IG_like 268..346 CDD:214653 23/87 (26%)
FN3 432..502 CDD:214495
LRR 6 526..549
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.