DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek5 and Igfals

DIOPT Version :9

Sequence 1:NP_001245746.1 Gene:kek5 / 32930 FlyBaseID:FBgn0031016 Length:931 Species:Drosophila melanogaster
Sequence 2:NP_001351825.1 Gene:Igfals / 16005 MGIID:107973 Length:638 Species:Mus musculus


Alignment Length:303 Identity:75/303 - (24%)
Similarity:108/303 - (35%) Gaps:125/303 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LDFAHNQIPELRREEFLLAGLPNVHKIFLRNCTIQEVHREAFKGLHILIELDLSGNRIRELHPGT 142
            ||.:||::..|..:.|  .||..:|.:.|.:..|..:....||.||.|.||.|..||||:|...|
Mouse   306 LDLSHNRVAGLLEDTF--PGLLGLHVLRLAHNAITSLRPRTFKDLHFLEELQLGHNRIRQLGEKT 368

  Fly   143 FAGLEKLRNVIINNNEI-EV-----------------------LPNHLFVNLSFLSRIEFRNNRL 183
            |.||.:|..:.:|:|:| ||                       ||.|:|..|..|..:...::.|
Mouse   369 FEGLGQLEVLTLNDNQIHEVKVGAFFGLFNVAVMNLSGNCLRSLPEHVFQGLGRLHSLHLEHSCL 433

  Fly   184 RQVQLHVFAGTMAL--------SAISLEQ----------------NRLSHLHKETFKDLQKLMHL 224
            .:::||.|||...|        |..|:|:                |:|:||.::.|:.|.:|.:|
Mouse   434 GRIRLHTFAGLSGLRRLFLRDNSISSIEEQSLAGLSELLELDLTANQLTHLPRQLFQGLGQLEYL 498

  Fly   225 -----------------------------------------------------SLQ--------- 227
                                                                 |||         
Mouse   499 LLSNNQLTMLSEDVLGPLQRAFWLDLSHNRLETPAEGLFSSLGRLRYLNLRNNSLQTFVPQPGLE 563

  Fly   228 -----GNAWNCSCELQDFRDFAISKRLYTP--------PTDCQ 257
                 .|.|:|||.|:..||||:......|        ..|||
Mouse   564 RLWLDANPWDCSCPLKALRDFALQNPGVVPRFVQTVCEGDDCQ 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek5NP_001245746.1 LRR_RI <76..160 CDD:238064 32/82 (39%)
leucine-rich repeat 76..100 CDD:275380 8/21 (38%)
LRR_8 99..159 CDD:290566 23/59 (39%)
leucine-rich repeat 101..124 CDD:275380 6/22 (27%)
LRR 122..145 CDD:197688 13/22 (59%)
leucine-rich repeat 125..148 CDD:275380 13/22 (59%)
LRR_8 148..207 CDD:290566 23/106 (22%)
leucine-rich repeat 149..172 CDD:275380 11/46 (24%)
leucine-rich repeat 173..196 CDD:275380 7/22 (32%)
LRR_8 197..>229 CDD:290566 15/122 (12%)
leucine-rich repeat 197..220 CDD:275380 10/46 (22%)
LRRCT 229..277 CDD:214507 14/37 (38%)
Ig 296..376 CDD:143165
IgfalsNP_001351825.1 LRRNT 75..113 CDD:214470
leucine-rich repeat 92..110 CDD:275380
PLN00113 96..>558 CDD:331614 61/253 (24%)
leucine-rich repeat 114..134 CDD:275380
leucine-rich repeat 135..158 CDD:275380
leucine-rich repeat 159..182 CDD:275380
leucine-rich repeat 183..206 CDD:275380
leucine-rich repeat 207..230 CDD:275380
leucine-rich repeat 231..254 CDD:275380
leucine-rich repeat 255..278 CDD:275380
leucine-rich repeat 279..302 CDD:275380
leucine-rich repeat 303..326 CDD:275380 8/21 (38%)
leucine-rich repeat 327..350 CDD:275380 6/22 (27%)
leucine-rich repeat 351..374 CDD:275380 13/22 (59%)
leucine-rich repeat 375..396 CDD:275380 6/20 (30%)
leucine-rich repeat 423..446 CDD:275380 7/22 (32%)
leucine-rich repeat 447..470 CDD:275380 4/22 (18%)
leucine-rich repeat 471..494 CDD:275380 6/22 (27%)
leucine-rich repeat 495..516 CDD:275380 2/20 (10%)
leucine-rich repeat 519..542 CDD:275380 0/22 (0%)
leucine-rich repeat 543..561 CDD:275380 3/17 (18%)
TPKR_C2 570..613 CDD:326558 14/37 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12130
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.