| Sequence 1: | NP_001245746.1 | Gene: | kek5 / 32930 | FlyBaseID: | FBgn0031016 | Length: | 931 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_032174.2 | Gene: | Gp5 / 14729 | MGIID: | 1096363 | Length: | 567 | Species: | Mus musculus |
| Alignment Length: | 213 | Identity: | 58/213 - (27%) |
|---|---|---|---|
| Similarity: | 93/213 - (43%) | Gaps: | 13/213 - (6%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 78 LDFAHNQIPELRREEFLLAGLPNVHKIFLRNCTIQEVHREAFKGLHILIELDLSGN-RIRELHPG 141
Fly 142 TFAGLEKLRNVIINNNEIEVLPNHLFVNLSFLSRIEFRNNRLRQVQLHVFAGTMALSAISLEQNR 206
Fly 207 LSHLHKETFKDLQKLMHLSLQGNAWNCSCELQDFRDFAISKRLYTPPTDCQEPPQLRG------- 264
Fly 265 KLWSEVPSENFACRPRIL 282 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek5 | NP_001245746.1 | LRR_RI | <76..160 | CDD:238064 | 22/82 (27%) |
| leucine-rich repeat | 76..100 | CDD:275380 | 5/21 (24%) | ||
| LRR_8 | 99..159 | CDD:290566 | 17/60 (28%) | ||
| leucine-rich repeat | 101..124 | CDD:275380 | 4/22 (18%) | ||
| LRR | 122..145 | CDD:197688 | 9/23 (39%) | ||
| leucine-rich repeat | 125..148 | CDD:275380 | 10/23 (43%) | ||
| LRR_8 | 148..207 | CDD:290566 | 16/58 (28%) | ||
| leucine-rich repeat | 149..172 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 173..196 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 197..>229 | CDD:290566 | 10/31 (32%) | ||
| leucine-rich repeat | 197..220 | CDD:275380 | 8/22 (36%) | ||
| LRRCT | 229..277 | CDD:214507 | 14/54 (26%) | ||
| Ig | 296..376 | CDD:143165 | |||
| Gp5 | NP_032174.2 | LRR 1 | 75..96 | ||
| LRR_8 | 76..134 | CDD:290566 | |||
| leucine-rich repeat | 76..99 | CDD:275380 | |||
| LRR 2 | 99..120 | ||||
| leucine-rich repeat | 100..123 | CDD:275380 | |||
| LRR 3 | 123..144 | ||||
| LRR_8 | 124..182 | CDD:290566 | |||
| leucine-rich repeat | 124..147 | CDD:275380 | |||
| LRR_RI | 126..402 | CDD:238064 | 36/132 (27%) | ||
| LRR 4 | 147..168 | ||||
| leucine-rich repeat | 148..171 | CDD:275380 | |||
| LRR 5 | 171..193 | ||||
| leucine-rich repeat | 172..195 | CDD:275380 | |||
| LRR_8 | 195..254 | CDD:290566 | |||
| LRR 6 | 195..216 | ||||
| leucine-rich repeat | 196..219 | CDD:275380 | |||
| LRR 7 | 219..240 | ||||
| leucine-rich repeat | 220..243 | CDD:275380 | |||
| LRR_8 | 243..302 | CDD:290566 | 6/32 (19%) | ||
| LRR 8 | 243..264 | ||||
| leucine-rich repeat | 244..267 | CDD:275380 | |||
| LRR 9 | 267..288 | 5/18 (28%) | |||
| leucine-rich repeat | 268..291 | CDD:275380 | 5/21 (24%) | ||
| LRR 10 | 291..312 | 3/20 (15%) | |||
| leucine-rich repeat | 292..315 | CDD:275380 | 4/22 (18%) | ||
| LRR_8 | 314..375 | CDD:290566 | 18/60 (30%) | ||
| LRR 11 | 315..337 | 8/21 (38%) | |||
| leucine-rich repeat | 316..338 | CDD:275380 | 8/21 (38%) | ||
| LRR 12 | 340..361 | 4/20 (20%) | |||
| leucine-rich repeat | 341..364 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 364..422 | CDD:290566 | 17/57 (30%) | ||
| LRR 13 | 364..385 | 7/20 (35%) | |||
| leucine-rich repeat | 365..388 | CDD:275380 | 7/22 (32%) | ||
| LRR 14 | 388..409 | 7/20 (35%) | |||
| leucine-rich repeat | 389..410 | CDD:275380 | 7/20 (35%) | ||
| TPKR_C2 | 421..>454 | CDD:301599 | 12/35 (34%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||