| Sequence 1: | NP_001245746.1 | Gene: | kek5 / 32930 | FlyBaseID: | FBgn0031016 | Length: | 931 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001073982.3 | Gene: | CPN2 / 1370 | HGNCID: | 2313 | Length: | 545 | Species: | Homo sapiens |
| Alignment Length: | 342 | Identity: | 80/342 - (23%) |
|---|---|---|---|
| Similarity: | 130/342 - (38%) | Gaps: | 106/342 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 17 LLLLGVLV----VLMALPPPTAGTTDWMQSCGTCHCQWNSGKKSADCKNKALTKIPQDM---SNE 74
Fly 75 MQVLDFAHNQIPELRREEF--------------LLAGLP--------NVHKIFLRNCTIQEVHRE 117
Fly 118 AFKGL--------------HI----------------------------------LIELDLSGNR 134
Fly 135 IRELHPGTFAGLEKLRNVIINNNEIEVLPNHLFVNLSFLSRIEFRNNRLRQVQLHVFAGTMALSA 199
Fly 200 ISLEQNRLSHLHKETFKDLQKLMHLSLQGNAWNCSCE-------LQDFRDFAISKRLYTPPTDCQ 257
Fly 258 EPPQLRGKLWSEVPSEN 274 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek5 | NP_001245746.1 | LRR_RI | <76..160 | CDD:238064 | 29/153 (19%) |
| leucine-rich repeat | 76..100 | CDD:275380 | 10/45 (22%) | ||
| LRR_8 | 99..159 | CDD:290566 | 20/115 (17%) | ||
| leucine-rich repeat | 101..124 | CDD:275380 | 6/36 (17%) | ||
| LRR | 122..145 | CDD:197688 | 9/70 (13%) | ||
| leucine-rich repeat | 125..148 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 148..207 | CDD:290566 | 16/58 (28%) | ||
| leucine-rich repeat | 149..172 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 173..196 | CDD:275380 | 4/22 (18%) | ||
| LRR_8 | 197..>229 | CDD:290566 | 10/31 (32%) | ||
| leucine-rich repeat | 197..220 | CDD:275380 | 7/22 (32%) | ||
| LRRCT | 229..277 | CDD:214507 | 17/53 (32%) | ||
| Ig | 296..376 | CDD:143165 | |||
| CPN2 | NP_001073982.3 | LRRNT | 21..53 | CDD:214470 | |
| leucine-rich repeat | 30..53 | CDD:275380 | |||
| leucine-rich repeat | 75..98 | CDD:275380 | |||
| LRR 1 | 98..119 | ||||
| leucine-rich repeat | 99..122 | CDD:275380 | 1/1 (100%) | ||
| LRR_8 | 121..181 | CDD:290566 | 16/73 (22%) | ||
| LRR 2 | 122..143 | 8/23 (35%) | |||
| leucine-rich repeat | 123..146 | CDD:275380 | 8/25 (32%) | ||
| LRR 3 | 146..167 | 5/31 (16%) | |||
| leucine-rich repeat | 147..170 | CDD:275380 | 5/33 (15%) | ||
| LRR_RI | 149..>356 | CDD:238064 | 42/217 (19%) | ||
| LRR_8 | 169..229 | CDD:290566 | 12/59 (20%) | ||
| LRR 4 | 170..191 | 6/20 (30%) | |||
| leucine-rich repeat | 171..194 | CDD:275380 | 6/22 (27%) | ||
| LRR 5 | 194..215 | 4/20 (20%) | |||
| leucine-rich repeat | 195..218 | CDD:275380 | 4/22 (18%) | ||
| LRR_8 | 218..277 | CDD:290566 | 7/58 (12%) | ||
| LRR 6 | 218..239 | 5/20 (25%) | |||
| leucine-rich repeat | 219..242 | CDD:275380 | 6/22 (27%) | ||
| LRR 7 | 242..263 | 1/20 (5%) | |||
| leucine-rich repeat | 243..266 | CDD:275380 | 1/22 (5%) | ||
| LRR 8 | 266..287 | 0/20 (0%) | |||
| leucine-rich repeat | 267..290 | CDD:275380 | 0/22 (0%) | ||
| LRR 9 | 290..311 | 7/20 (35%) | |||
| leucine-rich repeat | 291..314 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 294..349 | CDD:290566 | 18/54 (33%) | ||
| LRR 10 | 314..335 | 7/20 (35%) | |||
| leucine-rich repeat | 315..338 | CDD:275380 | 8/22 (36%) | ||
| LRR 11 | 338..359 | 4/20 (20%) | |||
| leucine-rich repeat | 339..359 | CDD:275380 | 4/19 (21%) | ||
| LRR 12 | 362..383 | 7/20 (35%) | |||
| leucine-rich repeat | 363..382 | CDD:275380 | 6/18 (33%) | ||
| leucine-rich repeat | 387..399 | CDD:275378 | 6/11 (55%) | ||
| LRRCT | 395..446 | CDD:214507 | 17/53 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||