| Sequence 1: | NP_001245746.1 | Gene: | kek5 / 32930 | FlyBaseID: | FBgn0031016 | Length: | 931 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001128529.2 | Gene: | LRRC15 / 131578 | HGNCID: | 20818 | Length: | 587 | Species: | Homo sapiens |
| Alignment Length: | 330 | Identity: | 89/330 - (26%) |
|---|---|---|---|
| Similarity: | 136/330 - (41%) | Gaps: | 71/330 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 84 QIPELRR--------EEF---LLAGLPNVHKIFLRNCTIQEVHREAFKGLHILIELDLSGNRIRE 137
Fly 138 LHPGTFAGLEKLRNVIINNNEIEVLPNHLFVNLSFLSRIEFRNNRLRQVQLHVFAGTMALSAISL 202
Fly 203 EQNRLSHLHKETFKDLQKLMHLSLQGNAWNCSCELQDFRDFAI--SKRLYTPPTD-CQEPPQLRG 264
Fly 265 KLWSEVPSENFACRPRILGSVRSFIEANHDNISLPCRIVGSPR----PNVTWVYNKRPLQQYDPR 325
Fly 326 VRVLTSVEQMPEQPSQVLTSELRIVGVRASDKGAYT-----CVADNRG--GRAEAEFQLLVSGDY 383
Fly 384 AGAVS 388 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek5 | NP_001245746.1 | LRR_RI | <76..160 | CDD:238064 | 25/86 (29%) |
| leucine-rich repeat | 76..100 | CDD:275380 | 5/26 (19%) | ||
| LRR_8 | 99..159 | CDD:290566 | 20/59 (34%) | ||
| leucine-rich repeat | 101..124 | CDD:275380 | 4/22 (18%) | ||
| LRR | 122..145 | CDD:197688 | 10/22 (45%) | ||
| leucine-rich repeat | 125..148 | CDD:275380 | 11/22 (50%) | ||
| LRR_8 | 148..207 | CDD:290566 | 21/58 (36%) | ||
| leucine-rich repeat | 149..172 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 173..196 | CDD:275380 | 10/22 (45%) | ||
| LRR_8 | 197..>229 | CDD:290566 | 13/31 (42%) | ||
| leucine-rich repeat | 197..220 | CDD:275380 | 9/22 (41%) | ||
| LRRCT | 229..277 | CDD:214507 | 11/50 (22%) | ||
| Ig | 296..376 | CDD:143165 | 20/90 (22%) | ||
| LRRC15 | NP_001128529.2 | LRR_8 | 60..119 | CDD:290566 | |
| LRR_RI | 63..309 | CDD:238064 | 8/35 (23%) | ||
| LRR_8 | 88..167 | CDD:290566 | |||
| leucine-rich repeat | 88..108 | CDD:275380 | |||
| leucine-rich repeat | 109..156 | CDD:275380 | |||
| leucine-rich repeat | 157..180 | CDD:275380 | |||
| LRR_8 | 180..239 | CDD:290566 | |||
| leucine-rich repeat | 181..204 | CDD:275380 | |||
| leucine-rich repeat | 205..228 | CDD:275380 | |||
| LRR_8 | 228..287 | CDD:290566 | 4/13 (31%) | ||
| leucine-rich repeat | 229..252 | CDD:275380 | |||
| leucine-rich repeat | 253..276 | CDD:275380 | 1/2 (50%) | ||
| leucine-rich repeat | 277..300 | CDD:275380 | 3/22 (14%) | ||
| LRR_8 | 299..359 | CDD:290566 | 20/59 (34%) | ||
| LRR_4 | 299..340 | CDD:289563 | 12/40 (30%) | ||
| leucine-rich repeat | 301..324 | CDD:275380 | 4/22 (18%) | ||
| LRR_4 | 324..364 | CDD:289563 | 15/39 (38%) | ||
| leucine-rich repeat | 325..348 | CDD:275380 | 11/22 (50%) | ||
| leucine-rich repeat | 349..370 | CDD:275380 | 5/20 (25%) | ||
| LRR_8 | 372..430 | CDD:290566 | 23/57 (40%) | ||
| leucine-rich repeat | 373..393 | CDD:275380 | 9/19 (47%) | ||
| leucine-rich repeat | 397..418 | CDD:275380 | 8/20 (40%) | ||
| TPKR_C2 | 429..>468 | CDD:301599 | 11/59 (19%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||