DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek5 and LRRN2

DIOPT Version :9

Sequence 1:NP_001245746.1 Gene:kek5 / 32930 FlyBaseID:FBgn0031016 Length:931 Species:Drosophila melanogaster
Sequence 2:NP_006329.2 Gene:LRRN2 / 10446 HGNCID:16914 Length:713 Species:Homo sapiens


Alignment Length:628 Identity:133/628 - (21%)
Similarity:197/628 - (31%) Gaps:233/628 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 MILLLLGVLVVLMALPPPTAGTTDWMQSC-GTCHCQ---WNSGKKS------ADCKNKALTKIPQ 69
            |.||:..:|:..:|..........|...| ..|.||   |.:.:.|      .||.:..||.:|.
Human     1 MRLLVAPLLLAWVAGATAAVPVVPWHVPCPPQCACQIRPWYTPRSSYREATTVDCNDLFLTAVPP 65

  Fly    70 -------------------DMSN-----EMQVLDFAHNQ-----------IPEL----------- 88
                               |.|.     .:..||.:.|.           :|:|           
Human    66 ALPAGTQTLLLQSNSIVRVDQSELGYLANLTELDLSQNSFSDARDCDFHALPQLLSLHLEENQLT 130

  Fly    89 RREEFLLAGLPNVHKIFLRNCTIQEVHREAFKGLHILIE-------------------------- 127
            |.|:...|||.::.:::|.:..:..:...||.||..|:.                          
Human   131 RLEDHSFAGLASLQELYLNHNQLYRIAPRAFSGLSNLLRLHLNSNLLRAIDSRWFEMLPNLEILM 195

  Fly   128 ----------------------------------------------------------------- 127
                                                                             
Human   196 IGGNKVDAILDMNFRPLANLRSLVLAGMNLREISDYALEGLQSLESLSFYDNQLARVPRRALEQV 260

  Fly   128 -----LDLSGNRIRELHPGTFAGLEKLRNVIINN-NEIEVLPNHLFVNLSFLSRIEFRNN-RLRQ 185
                 |||:.|.::.:.||.||.:..|:.:.:|| .|:..:.....|||..|::::..|| ||..
Human   261 PGLKFLDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVSIDKFALVNLPELTKLDITNNPRLSF 325

  Fly   186 VQLHVFAGTMALSAISLEQNRLSHLHKETFKDLQKLMHLSLQGNAWNCSCELQDFRDFAISKRLY 250
            :....|.....:..:.|..|.||.||::|.:.|..|..:.|.||...|.|.::.........|..
Human   326 IHPRAFHHLPQMETLMLNNNALSALHQQTVESLPNLQEVGLHGNPIRCDCVIRWANATGTRVRFI 390

  Fly   251 TP-PTDCQEPPQLRGKLWSEVPSENFA--CRPRILGSVRSFIE----ANHDNISLPCRIVGSPRP 308
            .| .|.|.|||.|:.....|||.....  |.|.|  |.|||..    |:.:::.|.||.:..|.|
Human   391 EPQSTLCAEPPDLQRLPVREVPFREMTDHCLPLI--SPRSFPPSLQVASGESMVLHCRALAEPEP 453

  Fly   309 NVTWVYNKRPLQQYDPRVRVLTSVEQ------MPEQPSQVLTSELRIVGVRASDKGAYTCVADN- 366
            .:.||         .|....||....      .||.     |.|||  .|.|.:.|.|||||.| 
Human   454 EIYWV---------TPAGLRLTPAHAGRRYRVYPEG-----TLELR--RVTAEEAGLYTCVAQNL 502

  Fly   367 -----------------RGGRAEAE-FQLLVSGDYAGAV------------------SASDGMGM 395
                             :.||.|.: .:|.|...:...:                  |||...|.
Human   503 VGADTKTVSVVVGRALLQPGRDEGQGLELRVQETHPYHILLSWVTPPNTVSTNLTWSSASSLRGQ 567

  Fly   396 GAIGAPTIDPQTNMFLIICLIITTLLLLLLVAVLTLFWYCRRI 438
            ||.....:...|:.:     .||.||      ..|.:|.|.::
Human   568 GATALARLPRGTHSY-----NITRLL------QATEYWACLQV 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek5NP_001245746.1 LRR_RI <76..160 CDD:238064 28/202 (14%)
leucine-rich repeat 76..100 CDD:275380 10/45 (22%)
LRR_8 99..159 CDD:290566 17/156 (11%)
leucine-rich repeat 101..124 CDD:275380 5/22 (23%)
LRR 122..145 CDD:197688 9/118 (8%)
leucine-rich repeat 125..148 CDD:275380 9/118 (8%)
LRR_8 148..207 CDD:290566 15/60 (25%)
leucine-rich repeat 149..172 CDD:275380 7/23 (30%)
leucine-rich repeat 173..196 CDD:275380 6/23 (26%)
LRR_8 197..>229 CDD:290566 10/31 (32%)
leucine-rich repeat 197..220 CDD:275380 8/22 (36%)
LRRCT 229..277 CDD:214507 14/50 (28%)
Ig 296..376 CDD:143165 28/104 (27%)
LRRN2NP_006329.2 leucine-rich repeat 51..69 CDD:275380 5/17 (29%)
LRR_RI 62..288 CDD:238064 27/225 (12%)
LRR 1 70..91 2/20 (10%)
leucine-rich repeat 71..94 CDD:275380 2/22 (9%)
LRR 2 94..115 3/20 (15%)
leucine-rich repeat 95..118 CDD:275380 3/22 (14%)
LRR_8 117..177 CDD:290566 13/59 (22%)
LRR 3 118..139 3/20 (15%)
leucine-rich repeat 119..142 CDD:275380 6/22 (27%)
LRR 4 142..163 3/20 (15%)
leucine-rich repeat 143..166 CDD:275380 5/22 (23%)
LRR_8 165..222 CDD:290566 1/56 (2%)
LRR 5 166..187 1/20 (5%)
leucine-rich repeat 167..190 CDD:275380 1/22 (5%)
LRR 6 190..211 0/20 (0%)
leucine-rich repeat 191..214 CDD:275380 0/22 (0%)
LRR_RI 209..>372 CDD:238064 33/162 (20%)
LRR_8 214..273 CDD:290566 4/58 (7%)
LRR 7 214..235 0/20 (0%)
leucine-rich repeat 215..238 CDD:275380 0/22 (0%)
LRR 8 238..259 0/20 (0%)
leucine-rich repeat 239..262 CDD:275380 0/22 (0%)
LRR 9 262..283 7/20 (35%)
leucine-rich repeat 263..286 CDD:275380 8/22 (36%)
LRR 10 286..305 4/18 (22%)
leucine-rich repeat 287..311 CDD:275380 7/23 (30%)
LRR_8 310..371 CDD:290566 18/60 (30%)
LRR 11 311..333 6/21 (29%)
leucine-rich repeat 312..334 CDD:275380 6/21 (29%)
LRR 12 336..357 7/20 (35%)
leucine-rich repeat 337..360 CDD:275378 8/22 (36%)
leucine-rich repeat 361..373 CDD:275378 4/11 (36%)
TPKR_C2 369..412 CDD:301599 12/42 (29%)
I-set 430..514 CDD:254352 26/99 (26%)
Ig 438..514 CDD:299845 25/91 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.