DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek5 and igsf10

DIOPT Version :9

Sequence 1:NP_001245746.1 Gene:kek5 / 32930 FlyBaseID:FBgn0031016 Length:931 Species:Drosophila melanogaster
Sequence 2:XP_012819117.2 Gene:igsf10 / 100494018 XenbaseID:XB-GENE-6072998 Length:2884 Species:Xenopus tropicalis


Alignment Length:1407 Identity:241/1407 - (17%)
Similarity:405/1407 - (28%) Gaps:628/1407 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLGVLVVL---------MALPPPTAGTTDWMQSCGTCHCQWNSGKKSADCKNKALTKIPQDMSNE 74
            |||.||..         .|.|.|.|           |:.     .....|..:.||.||:.::.:
 Frog    11 LLGFLVTFCLSFLSKCSFACPNPCA-----------CYV-----PTEVHCTFRYLTAIPKQINPD 59

  Fly    75 MQVLDFAHNQIPELRREEFLLAGLPNVHKIFLRNCTIQEVHREAFKGLHILIELDLSGNRIRELH 139
            ::.::..:|.|  ::.||...:||..:..:.|.:..|:.:|..|...|..|..|.:|.|:::..|
 Frog    60 VERINLGYNSI--IKLEEMDFSGLQKLELLMLHSNEIRAIHERALNDLSSLQVLKMSYNKVKSFH 122

  Fly   140 PGTFAGLEKLRNVIINNNEIEVLPNHLFVNLSFLSRIEFRNNRLRQVQ---------LHVFAGTM 195
            ..||.||:.|..:.:::|:::.:....|..|:.|..:....|.|.|:.         :|:|. |.
 Frog   123 KNTFHGLKNLVRLHMDHNKLDFINPESFYGLTSLKLVHLEGNLLTQLHTDTFLTLRYIHIFK-TS 186

  Fly   196 ALSAISLEQNRLSHLHKETFKDLQKLMHLSLQGNAWNCSCELQDFRDFAISKR-LYTPPTD---- 255
            ::..:.|..|:||.|.::.|..:.:|..:.|.||.|:|.|:|:..||:|...| :.....|    
 Frog   187 SIKQVYLSDNQLSSLPEDMFSYMTELEGIYLHGNPWSCDCKLEWLRDWAQQSRDIIKCKKDRSGQ 251

  Fly   256 ----CQEPPQLRGKLWSEVPSENFAC-RPRI----------------------------LGSV-- 285
                |..|.....|..:|:.||:.|| :|.|                            :||:  
 Frog   252 QCPLCASPRTNNAKTLTEISSEDLACIKPTIGETFKLKNTTATEEGGSIAVSPKDFVAPMGSLIL 316

  Fly   286 ----------------------------------------RSFIEANHD---------------- 294
                                                    .||:..|.|                
 Frog   317 NMTDQYGNEANLACSVQRPTNMSQISMDTKSDYSALRTTFFSFLVCNIDYDHIQKLWGILAMYSD 381

  Fly   295 ----------------------------------------------------------------- 294
                                                                             
 Frog   382 SPMKLKRDLLLTRTPFISYKYKQSASNDEVFTDIEAEIRTEPSWLMQDLVVLQLDRTATTLSTLH 446

  Fly   295 -------NISLP-----------------------------------CRIVGSPRPNVTWVYN-- 315
                   .|:||                                   |.::|.|.|.:.|:..  
 Frog   447 IRYMVDVYITLPSVPEKLFKTGWVMITKNNQTKTEYSAVIGGTVEMDCEVLGEPTPAIEWILPDG 511

  Fly   316 ---KRPLQQYDPRVR-------VLTSVEQMPEQPSQVLTSELRIVGVRASDKGAYTCVADNR--- 367
               :.|....:.|:.       :|.|.:..                    |.|.|.|:|.|.   
 Frog   512 SKIRAPYASQEGRITITKNGKFILKSADNF--------------------DTGIYHCIATNYIDA 556

  Fly   368 ----------GGRAEAEF----QLLVS-GDYAGAVSASDGMGMGAIG------APTIDPQTNMFL 411
                      ....|.:|    :|.|| |||......|.|:...::.      :...:|..|..:
 Frog   557 DVLSFRITVVSSDVEEQFVNGVELSVSNGDYINLPCGSSGVPDASVSWILPDHSVLYEPSRNKII 621

  Fly   412 II------------------CL--------IITTLLLLLLVAVLTLFWYCRRIK----------- 439
            :.                  ||        |:|..:|:....:..:      ||           
 Frog   622 LANGTLKIQGISERDSGHFRCLAANQYGLDILTHRVLVKERQINVI------IKETENDDGSGNE 680

  Fly   440 --------------TYQKDTTMMSGDGLISSKMDKTHN----------GSMLEGSVIMEMQKSLL 480
                          |.||.|.:....|.:.|:  |||.          ...|.|      |:...
 Frog   681 DNEELNKQSAMGRVTVQKKTPVHIESGHVLSR--KTHRNIGIHRRKKISRRLRG------QRRKF 737

  Fly   481 NEVN----PV-------------EKPPRRT------------------DIESVDGGDDVLEIK-- 508
            .::|    ||             :||...|                  |:|. ..|:::|.:|  
 Frog   738 TQINRKIDPVRWTEILEKTKQNSKKPKVETKIFESSLKEEYTIGRASGDLEE-SSGEELLPVKEK 801

  Fly   509 --------------------KTLLDDTVYVANHSRDEEAVSV----------AMSDTTTTPR--S 541
                                ||:.|........::...:||.          .|::|.:.|.  :
 Frog   802 FFILTTRHSAITKLNVVPTTKTVTDSKTLQTQPTKKPSSVSTPRAETETMENLMANTVSAPSEPT 866

  Fly   542 RHTYVDDA---------------YA---------------------------------NSL---P 555
            .|:.:::.               ||                                 |||   |
 Frog   867 THSLLNNTSMELISKPQPTSSGLYATPKDLTTTSLLGNAAIFHHGKPQDPKKELTTTFNSLTVTP 931

  Fly   556 PDLLAFP----ARVPPTSPS----------MQSSQSNIPDQVI--------YGIRSPPSLTSPVY 598
            ..::..|    :.:..||||          ...||.:|.:.::        .||.|.||.||..:
 Frog   932 QTVITSPSSTSSNIYTTSPSPATPATPSYFQAKSQQSITEYIVPEYLHFSTQGINSNPSTTSNYF 996

  Fly   599 THMTPHGIYGTK--------------TMTAPHNGFMTLQHPKSRNLALIATTNSSRQHQHHHQLQ 649
            ...:.:.:..|.              .:|.|.|.|...  ||.: |....||:|        .||
 Frog   997 NFPSRNVLKKTPVSNISSSSVPTIIINLTTPSNKFSLT--PKDK-LTYQPTTSS--------YLQ 1050

  Fly   650 QQQQHHHHHQQQQQQQQQQQHPLATTSPFLPAPVVYSPATGVVMKQGYMTIPRKPRAPSW--APS 712
            :..|:..:..|:...::....|.|    .||    |.|.|...::.....:..||::..:  .|.
 Frog  1051 ETSQNVINKPQRTAHEKVPSRPKA----ILP----YQPTTSSYLQGTSQNVISKPQSAPYLKLPF 1107

  Fly   713 TSGAAGHGSIQLSEFQSPTSPNPS---ETGTATTAELQAEPVYDNLGLRTTAGGNSTLNLTKIAG 774
            |:             :.|....||   ||.....::.|..|            .|...:..|:..
 Frog  1108 TT-------------KVPYQTTPSSLYETSQYILSKPQTTP------------SNKLSSSPKVLV 1147

  Fly   775 SQGGAGQQYSMRDRPLPATPSLTSVSSATNASKIYEPIHELIQQQQQLQQQQQQQQQRLGSMDTE 839
            :...:    .:::.|:|......|.:.|....||....|..|...:|             .:.||
 Frog  1148 TTTSS----YLKETPIPLNKPFVSTTPAKPKDKIQSTPHSQISNGEQ-------------DLITE 1195

  Fly   840 PLYGVRQQGITILPG--SSISGAGLGHAAYLSPGSGAAVSPSHASSSGDSPKAAKIPPR---PPP 899
                |.|:.:.|:..  ::......||            |.:...:..|.|:....|.:   |..
 Frog  1196 ----VSQKELNIVSALITNTESHSFGH------------SSTSMQAKTDIPETTSKPSKENVPYS 1244

  Fly   900 K---------PKKKM-SVTTTRSGQGST---SQLFDDEGEDG 928
            |         |.||: :.|.|::|..||   ::||..|.|.|
 Frog  1245 KSKTITQTKIPTKKVPNFTETKNGASSTKSSTKLFLSETEIG 1286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek5NP_001245746.1 LRR_RI <76..160 CDD:238064 22/83 (27%)
leucine-rich repeat 76..100 CDD:275380 6/23 (26%)
LRR_8 99..159 CDD:290566 16/59 (27%)
leucine-rich repeat 101..124 CDD:275380 5/22 (23%)
LRR 122..145 CDD:197688 8/22 (36%)
leucine-rich repeat 125..148 CDD:275380 9/22 (41%)
LRR_8 148..207 CDD:290566 13/67 (19%)
leucine-rich repeat 149..172 CDD:275380 4/22 (18%)
leucine-rich repeat 173..196 CDD:275380 7/31 (23%)
LRR_8 197..>229 CDD:290566 8/31 (26%)
leucine-rich repeat 197..220 CDD:275380 6/22 (27%)
LRRCT 229..277 CDD:214507 16/56 (29%)
Ig 296..376 CDD:143165 20/143 (14%)
igsf10XP_012819117.2 leucine-rich repeat 40..59 CDD:275380 5/18 (28%)
leucine-rich repeat 60..83 CDD:275380 6/24 (25%)
PPP1R42 68..221 CDD:411060 40/155 (26%)
LRR_8 82..142 CDD:404697 16/59 (27%)
leucine-rich repeat 84..107 CDD:275380 5/22 (23%)
leucine-rich repeat 108..131 CDD:275380 9/22 (41%)
leucine-rich repeat 132..155 CDD:275380 4/22 (18%)
leucine-rich repeat 156..187 CDD:275380 7/31 (23%)
leucine-rich repeat 188..211 CDD:275380 6/22 (27%)
PCC 193..>277 CDD:188093 25/83 (30%)
Ig 477..552 CDD:416386 14/94 (15%)
Ig strand A' 481..484 CDD:409353 0/2 (0%)
Ig strand B 490..497 CDD:409353 1/6 (17%)
Ig strand C 503..509 CDD:409353 1/5 (20%)
Ig strand C' 511..517 CDD:409353 0/5 (0%)
Ig strand D 524..528 CDD:409353 1/3 (33%)
Ig strand E 531..536 CDD:409353 0/4 (0%)
Ig strand F 544..552 CDD:409353 4/7 (57%)
IGc2 585..649 CDD:197706 9/63 (14%)
Ig strand C 601..606 CDD:409353 0/4 (0%)
Ig strand C' 608..612 CDD:409353 0/3 (0%)
Ig strand D 617..622 CDD:409353 1/4 (25%)
Ig strand E 625..631 CDD:409353 0/5 (0%)
Ig strand F 638..646 CDD:409353 2/7 (29%)
Herpes_BLLF1 <885..1272 CDD:282904 84/463 (18%)
Ig_3 1904..1984 CDD:404760
Ig strand C 1936..1940 CDD:409353
Ig strand E 1963..1967 CDD:409353
Ig strand F 1977..1982 CDD:409353
Ig strand G 1991..1994 CDD:409353
Ig_3 2001..2081 CDD:404760
Ig strand A' 2011..2014 CDD:409353
Ig strand B 2020..2027 CDD:409353
Ig strand C 2033..2038 CDD:409353
Ig strand C' 2040..2042 CDD:409353
Ig strand D 2053..2057 CDD:409353
Ig strand E 2060..2065 CDD:409353
Ig strand F 2073..2081 CDD:409353
Ig strand G 2084..2094 CDD:409353
Ig_3 2098..2177 CDD:404760
Ig strand A 2098..2101 CDD:409353
Ig strand A' 2107..2110 CDD:409353
Ig strand B 2117..2124 CDD:409353
Ig strand C 2130..2136 CDD:409353
Ig strand C' 2142..2144 CDD:409353
Ig strand D 2150..2155 CDD:409353
Ig strand E 2157..2161 CDD:409353
Ig strand F 2170..2178 CDD:409353
Ig strand G 2181..2191 CDD:409353
Ig_3 2198..2277 CDD:404760
Ig strand B 2214..2223 CDD:409353
Ig strand C 2229..2238 CDD:409353
Ig strand D 2250..2253 CDD:409353
Ig strand E 2256..2262 CDD:409353
Ig strand F 2269..2277 CDD:409353
Ig_3 2293..2380 CDD:404760
Ig strand A' 2304..2309 CDD:409353
Ig strand C 2326..2330 CDD:409353
Ig strand D 2355..2358 CDD:409353
Ig strand E 2359..2364 CDD:409353
Ig strand F 2372..2380 CDD:409353
IGc2 2413..2477 CDD:197706
Ig strand B 2416..2420 CDD:409353
Ig strand C 2429..2433 CDD:409353
Ig strand E 2453..2457 CDD:409353
Ig strand F 2467..2472 CDD:409353
Ig strand B 2515..2521 CDD:409353
IG_like 2516..2587 CDD:214653
Ig strand C 2527..2532 CDD:409353
Ig strand C' 2534..2536 CDD:409353
Ig strand D 2546..2550 CDD:409353
Ig strand E 2553..2558 CDD:409353
Ig strand F 2566..2574 CDD:409353
Ig strand G 2577..2587 CDD:409353
Ig 2612..2675 CDD:409353
Ig strand B 2612..2616 CDD:409353
Ig strand C 2625..2629 CDD:409353
Ig strand E 2651..2655 CDD:409353
Ig strand F 2665..2670 CDD:409353
Ig_3 2688..2767 CDD:404760
Ig strand B 2707..2711 CDD:409353
Ig strand C 2720..2724 CDD:409353
Ig strand E 2746..2750 CDD:409353
Ig strand F 2760..2765 CDD:409353
Ig_3 2784..2866 CDD:404760
Ig strand A 2785..2790 CDD:409353
Ig strand A' 2793..2798 CDD:409353
Ig strand B 2801..2810 CDD:409353
Ig strand C 2816..2820 CDD:409353
Ig strand C' 2823..2825 CDD:409353
Ig strand D 2841..2844 CDD:409353
Ig strand E 2845..2850 CDD:409353
Ig strand F 2858..2866 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.