Sequence 1: | NP_001245746.1 | Gene: | kek5 / 32930 | FlyBaseID: | FBgn0031016 | Length: | 931 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017944840.1 | Gene: | XB6050834 / 100488256 | XenbaseID: | XB-GENE-6050835 | Length: | 353 | Species: | Xenopus tropicalis |
Alignment Length: | 309 | Identity: | 75/309 - (24%) |
---|---|---|---|
Similarity: | 130/309 - (42%) | Gaps: | 61/309 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 LLGVLVVLMALPPPTAGTTDWMQSC-GTCHCQWNSGKKSADCKNKALTKIPQDMSNEMQVLDFAH 82
Fly 83 NQIPELRREEFLLAGLPNVHKIFLRNCTIQEVHREAFKGLHILIELDLSGNR------------- 134
Fly 135 -IREL----------------------------------HPGTFAGLEKLRNVIINNNEIEVLPN 164
Fly 165 HLFVNLSFLSRIEFRNNRLRQVQLHVFAGTMALSAISLEQNRLSHLHKETFKDLQ-KLMHLSLQG 228
Fly 229 NAWNCSCELQD-FRDFAISKRLYTPPTD---CQEPPQLRGKLWSEVPSE 273 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek5 | NP_001245746.1 | LRR_RI | <76..160 | CDD:238064 | 28/131 (21%) |
leucine-rich repeat | 76..100 | CDD:275380 | 7/23 (30%) | ||
LRR_8 | 99..159 | CDD:290566 | 21/107 (20%) | ||
leucine-rich repeat | 101..124 | CDD:275380 | 5/22 (23%) | ||
LRR | 122..145 | CDD:197688 | 12/70 (17%) | ||
leucine-rich repeat | 125..148 | CDD:275380 | 13/70 (19%) | ||
LRR_8 | 148..207 | CDD:290566 | 11/58 (19%) | ||
leucine-rich repeat | 149..172 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 173..196 | CDD:275380 | 3/22 (14%) | ||
LRR_8 | 197..>229 | CDD:290566 | 11/32 (34%) | ||
leucine-rich repeat | 197..220 | CDD:275380 | 10/23 (43%) | ||
LRRCT | 229..277 | CDD:214507 | 16/49 (33%) | ||
Ig | 296..376 | CDD:143165 | |||
XB6050834 | XP_017944840.1 | LRR | <34..>234 | CDD:227223 | 43/201 (21%) |
leucine-rich repeat | 53..76 | CDD:275380 | 7/24 (29%) | ||
leucine-rich repeat | 77..100 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 101..124 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 125..148 | CDD:275380 | 3/22 (14%) | ||
leucine-rich repeat | 149..172 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 173..196 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 197..220 | CDD:275380 | 3/22 (14%) | ||
PCC | 226..>296 | CDD:188093 | 25/69 (36%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 53 | 1.000 | Domainoid score | I11184 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |