DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek5 and lrfn1.2

DIOPT Version :9

Sequence 1:NP_001245746.1 Gene:kek5 / 32930 FlyBaseID:FBgn0031016 Length:931 Species:Drosophila melanogaster
Sequence 2:XP_002940406.1 Gene:lrfn1.2 / 100486910 XenbaseID:XB-GENE-22064095 Length:644 Species:Xenopus tropicalis


Alignment Length:406 Identity:102/406 - (25%)
Similarity:162/406 - (39%) Gaps:76/406 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 MILLLLGVLVVLMALPPPTAGTTDWMQSC-GTCHCQWNSGKKSADCKNKALTKIPQDMSNEMQVL 78
            ||.|..||.|.               |.| ..|.||..:...:..|....|..:|..:......|
 Frog     8 MITLTAGVAVA---------------QICPKRCLCQNLAPSLAILCAKTGLLFVPSVIDPRTVEL 57

  Fly    79 DFAHNQIPELRREEFLLAGLPNVHKIFLRNCTIQEVHREAFKGLHILIELDLSGNRIRELHPGTF 143
            ....|.|..:||.:|  ..:..:..:.|...||..:....|..|..|..|.|..|||..:.....
 Frog    58 RLTDNFITVIRRRDF--TNMTRLLHLTLSRNTISHITPYTFADLRGLRALHLDNNRILSMGDEQL 120

  Fly   144 AGLEKLRNVIINNNEIEVLPNHLFVN-LSFLSRIEFRNNRLRQVQLHVFAGTMALSAISLEQNRL 207
            .||:.||::|::||::..:....|.: :..|..::...|.|.:|.....:..|.::::||:.|.:
 Frog   121 KGLQNLRHLILSNNQLSTISPGSFQDFVGTLEDLDLSYNNLVKVPWETISKLMNVNSLSLDHNLI 185

  Fly   208 SHLHKETFKDLQKLMHLSLQ-----------------------------------GNAWNCSCEL 237
            .::....|.:|.||..|.:.                                   ||..:|:|||
 Frog   186 EYVPGGVFTNLHKLARLDMTSNKLKTIPPDPLFLRIPVYAKSKGSPLSSLVLGFGGNPLHCNCEL 250

  Fly   238 QDFRDFAISKRLYTPPTDCQEPPQLRGKLWSEVPSENFACRPRIL--GSVR-SFIEANHDNISLP 299
            ...|.|.....|.|    |..|..|.||.:..:..|.|.|.|.::  .|:| |.:|.  :.:.|.
 Frog   251 LWLRRFTREDDLET----CASPSNLMGKYFWSISEEEFMCDPPVVTHHSMRTSVLEG--EGVVLK 309

  Fly   300 CRIVGSPRPNVTWVYNKRPLQQYDPRVRVLTSVEQMPEQPSQVLTSELRIVGVRASDKGAYTCVA 364
            |:.||.|.|::.||         .|..:|:::..:.....:..|  |:.|..||  |.|::||:|
 Frog   310 CKAVGDPEPSIHWV---------SPEGKVVSNSSRAVSYENGTL--EITITTVR--DSGSFTCIA 361

  Fly   365 DNRGGRAEAEFQLLVS 380
            .|..|.|.|..:|:||
 Frog   362 SNTAGDATASVELVVS 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek5NP_001245746.1 LRR_RI <76..160 CDD:238064 24/83 (29%)
leucine-rich repeat 76..100 CDD:275380 6/23 (26%)
LRR_8 99..159 CDD:290566 18/59 (31%)
leucine-rich repeat 101..124 CDD:275380 5/22 (23%)
LRR 122..145 CDD:197688 7/22 (32%)
leucine-rich repeat 125..148 CDD:275380 8/22 (36%)
LRR_8 148..207 CDD:290566 14/59 (24%)
leucine-rich repeat 149..172 CDD:275380 6/23 (26%)
leucine-rich repeat 173..196 CDD:275380 4/22 (18%)
LRR_8 197..>229 CDD:290566 8/66 (12%)
leucine-rich repeat 197..220 CDD:275380 5/22 (23%)
LRRCT 229..277 CDD:214507 16/47 (34%)
Ig 296..376 CDD:143165 24/79 (30%)
lrfn1.2XP_002940406.1 leucine-rich repeat 54..77 CDD:275380 6/24 (25%)
LRR_8 56..112 CDD:338972 15/57 (26%)
leucine-rich repeat 78..101 CDD:275380 5/22 (23%)
LRR_8 101..161 CDD:338972 16/59 (27%)
leucine-rich repeat 102..125 CDD:275380 8/22 (36%)
leucine-rich repeat 126..149 CDD:275380 6/22 (27%)
LRR_8 150..209 CDD:338972 13/58 (22%)
leucine-rich repeat 151..174 CDD:275380 4/22 (18%)
leucine-rich repeat 175..198 CDD:275380 5/22 (23%)
leucine-rich repeat 199..234 CDD:275380 2/34 (6%)
LRRCT 242..>271 CDD:214507 11/32 (34%)
Ig 303..376 CDD:386229 25/87 (29%)
fn3 426..492 CDD:365830
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm14083
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.