| Sequence 1: | NP_001245746.1 | Gene: | kek5 / 32930 | FlyBaseID: | FBgn0031016 | Length: | 931 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_021323398.1 | Gene: | slitrk3a / 100334261 | ZFINID: | ZDB-GENE-130226-1 | Length: | 871 | Species: | Danio rerio |
| Alignment Length: | 380 | Identity: | 92/380 - (24%) |
|---|---|---|---|
| Similarity: | 145/380 - (38%) | Gaps: | 107/380 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 19 LLGVLVVLMALPPPTAGTTDWM-QSC-GTCHCQWNSGKKSADCKNKALTKIPQDMSNEMQ--VLD 79
Fly 80 FAHNQIPELRREEFLLAGLPNVHKIFLRNCTIQEVHREAFKGLHILIELDLSGNR---------- 134
Fly 135 --------------IRELHPGTFAGLEKLRNVIINNNEIEVLPNHLFVNLSFLSRIEFRNNRLRQ 185
Fly 186 VQLHVFAGTMALSAISLEQNRLSHLHKETFKDLQKLMHLSLQGNAWNCSCELQDFRDFAISKRLY 250
Fly 251 TP---PTDCQEPPQLRGK------------LWSEVPSENFACRPRILGSVRSFIEANHDNI--SL 298
Fly 299 PCRIVGS--------------------PRPNVT-----WVY---NKRPLQQYDPR 325 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek5 | NP_001245746.1 | LRR_RI | <76..160 | CDD:238064 | 30/109 (28%) |
| leucine-rich repeat | 76..100 | CDD:275380 | 6/25 (24%) | ||
| LRR_8 | 99..159 | CDD:290566 | 24/83 (29%) | ||
| leucine-rich repeat | 101..124 | CDD:275380 | 8/22 (36%) | ||
| LRR | 122..145 | CDD:197688 | 9/46 (20%) | ||
| leucine-rich repeat | 125..148 | CDD:275380 | 8/46 (17%) | ||
| LRR_8 | 148..207 | CDD:290566 | 22/58 (38%) | ||
| leucine-rich repeat | 149..172 | CDD:275380 | 12/22 (55%) | ||
| leucine-rich repeat | 173..196 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 197..>229 | CDD:290566 | 3/31 (10%) | ||
| leucine-rich repeat | 197..220 | CDD:275380 | 0/22 (0%) | ||
| LRRCT | 229..277 | CDD:214507 | 16/62 (26%) | ||
| Ig | 296..376 | CDD:143165 | 11/60 (18%) | ||
| slitrk3a | XP_021323398.1 | leucine-rich repeat | 68..89 | CDD:275380 | 6/22 (27%) |
| LRR_8 | 92..148 | CDD:316378 | 13/55 (24%) | ||
| leucine-rich repeat | 92..113 | CDD:275380 | 8/20 (40%) | ||
| leucine-rich repeat | 114..137 | CDD:275380 | 4/22 (18%) | ||
| LRR_8 | 137..195 | CDD:316378 | 21/58 (36%) | ||
| leucine-rich repeat | 138..161 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 162..184 | CDD:275380 | 12/21 (57%) | ||
| leucine-rich repeat | 185..365 | CDD:275380 | 42/198 (21%) | ||
| leucine-rich repeat | 211..270 | CDD:275380 | 15/59 (25%) | ||
| TPKR_C2 | 219..269 | CDD:326558 | 12/50 (24%) | ||
| leucine-rich repeat | 374..394 | CDD:275380 | |||
| leucine-rich repeat | 396..418 | CDD:275378 | |||
| LRR_8 | 417..477 | CDD:316378 | |||
| leucine-rich repeat | 419..442 | CDD:275378 | |||
| leucine-rich repeat | 443..466 | CDD:275378 | |||
| leucine-rich repeat | 467..490 | CDD:275378 | |||
| LRR_8 | 489..548 | CDD:316378 | |||
| leucine-rich repeat | 491..504 | CDD:275378 | |||
| leucine-rich repeat | 514..538 | CDD:275380 | |||
| LRRCT | 547..597 | CDD:214507 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||