DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek5 and lrit3b

DIOPT Version :9

Sequence 1:NP_001245746.1 Gene:kek5 / 32930 FlyBaseID:FBgn0031016 Length:931 Species:Drosophila melanogaster
Sequence 2:XP_009305418.1 Gene:lrit3b / 100144406 ZFINID:ZDB-GENE-070424-130 Length:487 Species:Danio rerio


Alignment Length:373 Identity:99/373 - (26%)
Similarity:140/373 - (37%) Gaps:72/373 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 TCHCQWNS---GKKSADCKNKALTKIPQDMSNEMQVLDFAHNQIPELRREEFLLAGLPNVHKIFL 106
            ||..|..|   |.::..|||.|||.||.|:.|:                          ..|..|
Zfish    57 TCVLQGRSDTKGLRTVLCKNPALTAIPIDLPND--------------------------TVKFRL 95

  Fly   107 RNCTIQEVHREAFKGLHILIELDLSGNRIRELHPGTFAGLEKLRNVIINNNEIEVLPNHLFVNLS 171
            ...::..:.|.||..:..|:.|.|:.|.|..|||.:|..|..|..:.::.|.:...|.....::.
Zfish    96 ERTSVSRIFRGAFSAMPELLYLWLTYNSISVLHPRSFTNLSSLHELRLDGNLLSTFPWEGLRDMP 160

  Fly   172 FLSRIEFRNNRLRQVQLHVFAGTMALSAISLEQNRLSHLHKE-----TFKD---LQKLMHLSLQG 228
            .|..:...||||.::.|........::.:.|..||||.|..:     .|.|   .|:...|.||.
Zfish   161 RLRTLGLHNNRLARIPLLAVRYLRNVTYLDLSSNRLSTLANDLTALWLFSDSNQTQRSFVLGLQD 225

  Fly   229 NAWNCSCELQDFRDFA--------ISKRLYTPPTDCQEPPQLRGKLWSEVPSENFAC-RPRILGS 284
            |.|.|.|.|....|.:        :..|..|    |.||..|.|..:..|  |...| ||.::.|
Zfish   226 NPWVCDCRLSTLLDISRGPESSLVLLDRFLT----CSEPLDLAGVPFQSV--ELSRCRRPYVVTS 284

  Fly   285 VRSFIEANHDNISLPCRIVGSPRPNVTWV-------YNKRPLQQYDPRVRVLTSVEQMP------ 336
            ...........:.|.|...|.|.|.:.|:       ||:...:|....:    ..|:.|      
Zfish   285 ATKITALLGSTVLLRCEATGHPTPALMWIKSAKRNLYNQGCCKQTQSSL----DTERFPKKLFGY 345

  Fly   337 --EQPS-QVLTSELRIVGVRASDKGAYTCVADNRGGRAEAEFQLLVSG 381
              |.|. .|..|.:.:.|:..||.|.|.|.|.|..|.:||...|.|.|
Zfish   346 VQESPRVGVRWSVVSLNGISYSDAGEYRCRAQNMAGISEAVVSLNVVG 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek5NP_001245746.1 LRR_RI <76..160 CDD:238064 17/83 (20%)
leucine-rich repeat 76..100 CDD:275380 0/23 (0%)
LRR_8 99..159 CDD:290566 17/59 (29%)
leucine-rich repeat 101..124 CDD:275380 5/22 (23%)
LRR 122..145 CDD:197688 9/22 (41%)
leucine-rich repeat 125..148 CDD:275380 10/22 (45%)
LRR_8 148..207 CDD:290566 11/58 (19%)
leucine-rich repeat 149..172 CDD:275380 3/22 (14%)
leucine-rich repeat 173..196 CDD:275380 6/22 (27%)
LRR_8 197..>229 CDD:290566 12/39 (31%)
leucine-rich repeat 197..220 CDD:275380 8/30 (27%)
LRRCT 229..277 CDD:214507 15/55 (27%)
Ig 296..376 CDD:143165 26/95 (27%)
lrit3bXP_009305418.1 LRRNT 51..92 CDD:214470 15/60 (25%)
leucine-rich repeat 69..89 CDD:275380 9/19 (47%)
LRR_8 112..172 CDD:290566 16/59 (27%)
leucine-rich repeat 114..137 CDD:275378 10/22 (45%)
leucine-rich repeat 138..161 CDD:275378 3/22 (14%)
LRR_8 160..214 CDD:290566 14/53 (26%)
LRR_4 160..201 CDD:289563 12/40 (30%)
leucine-rich repeat 162..185 CDD:275378 6/22 (27%)
leucine-rich repeat 186..199 CDD:275378 5/12 (42%)
leucine-rich repeat 215..230 CDD:275378 6/14 (43%)
Ig 278..391 CDD:299845 30/116 (26%)
I-set 279..391 CDD:254352 29/115 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5089
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.