| Sequence 1: | NP_001245746.1 | Gene: | kek5 / 32930 | FlyBaseID: | FBgn0031016 | Length: | 931 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_852607.3 | Gene: | LRRC70 / 100130733 | HGNCID: | 35155 | Length: | 622 | Species: | Homo sapiens |
| Alignment Length: | 297 | Identity: | 81/297 - (27%) |
|---|---|---|---|
| Similarity: | 125/297 - (42%) | Gaps: | 69/297 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 64 LTKIPQDMSNEMQV------LDFAHNQIPELRREEFLLAGLPNVHKIFLRNCTIQEVHREAFKGL 122
Fly 123 HILIELDLSGNRIRELHPGTFAGLEKLRNVIINNNEIEVLPNHLFVNLSFLSRIEFRNNRLRQVQ 187
Fly 188 LHVFAGTMALSAISLEQNRLSHLHKETFKDLQKLMHLSLQGNAWNCSCELQDFRDF----AISKR 248
Fly 249 LYTPPTDCQEPPQLRGKLWSEVPSENFACRPRILGSVRSFIEANHDNISLPCRIVGSPRPN---- 309
Fly 310 ---VTW---VYNKRPLQQYDPRVRVLTSVEQMPEQPS 340 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek5 | NP_001245746.1 | LRR_RI | <76..160 | CDD:238064 | 27/89 (30%) |
| leucine-rich repeat | 76..100 | CDD:275380 | 8/29 (28%) | ||
| LRR_8 | 99..159 | CDD:290566 | 19/59 (32%) | ||
| leucine-rich repeat | 101..124 | CDD:275380 | 7/22 (32%) | ||
| LRR | 122..145 | CDD:197688 | 8/22 (36%) | ||
| leucine-rich repeat | 125..148 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 148..207 | CDD:290566 | 9/58 (16%) | ||
| leucine-rich repeat | 149..172 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 173..196 | CDD:275380 | 0/22 (0%) | ||
| LRR_8 | 197..>229 | CDD:290566 | 11/31 (35%) | ||
| leucine-rich repeat | 197..220 | CDD:275380 | 8/22 (36%) | ||
| LRRCT | 229..277 | CDD:214507 | 16/51 (31%) | ||
| Ig | 296..376 | CDD:143165 | 12/55 (22%) | ||
| LRRC70 | NP_852607.3 | LRRNT | 31..62 | CDD:214470 | |
| LRR 1 | 61..82 | ||||
| leucine-rich repeat | 65..85 | CDD:275380 | |||
| LRR_8 | 85..144 | CDD:290566 | |||
| LRR 2 | 85..106 | ||||
| leucine-rich repeat | 86..109 | CDD:275380 | |||
| LRR 3 | 109..130 | ||||
| leucine-rich repeat | 110..133 | CDD:275380 | |||
| LRR_8 | 133..192 | CDD:290566 | |||
| LRR 4 | 133..154 | ||||
| leucine-rich repeat | 134..157 | CDD:275380 | |||
| LRR 5 | 157..178 | ||||
| leucine-rich repeat | 158..181 | CDD:275380 | |||
| LRR_RI | <159..340 | CDD:238064 | 41/151 (27%) | ||
| LRR 6 | 181..202 | ||||
| LRR_8 | 182..240 | CDD:290566 | 10/26 (38%) | ||
| leucine-rich repeat | 182..205 | CDD:275380 | |||
| LRR 7 | 205..226 | 6/12 (50%) | |||
| leucine-rich repeat | 206..229 | CDD:275380 | 7/15 (47%) | ||
| LRR_8 | 228..288 | CDD:290566 | 20/61 (33%) | ||
| LRR 8 | 229..250 | 5/22 (23%) | |||
| leucine-rich repeat | 230..253 | CDD:275380 | 7/24 (29%) | ||
| LRR 9 | 253..274 | 7/20 (35%) | |||
| leucine-rich repeat | 254..277 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 277..337 | CDD:290566 | 18/82 (22%) | ||
| LRR 10 | 277..298 | 8/20 (40%) | |||
| leucine-rich repeat | 278..301 | CDD:275380 | 9/22 (41%) | ||
| LRR 11 | 301..322 | 5/20 (25%) | |||
| leucine-rich repeat | 302..326 | CDD:275380 | 6/46 (13%) | ||
| LRR 12 | 326..347 | 6/20 (30%) | |||
| leucine-rich repeat | 327..348 | CDD:275380 | 7/20 (35%) | ||
| LRRCT | 359..398 | CDD:214507 | 16/43 (37%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||