Sequence 1: | NP_001245746.1 | Gene: | kek5 / 32930 | FlyBaseID: | FBgn0031016 | Length: | 931 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001093719.1 | Gene: | lingo1 / 100101739 | XenbaseID: | XB-GENE-921957 | Length: | 606 | Species: | Xenopus tropicalis |
Alignment Length: | 520 | Identity: | 103/520 - (19%) |
---|---|---|---|
Similarity: | 163/520 - (31%) | Gaps: | 195/520 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 MILLLLGVL--VVLMALPPPTAGTTDWMQSCGTC--HCQWNSGKKSADCKNKALTKIPQDMSNEM 75
Fly 76 QVLDFAHNQIPELRREEFLLAGLPNVHKIFLRNCTIQEVHREAFKGLHILIELDLSGNRIRELHP 140
Fly 141 GTFAGLEKLRNVIINNNEIEVLPNHLFVNLSFLSRIEFRNNRLRQVQLHVFAGTMALSAISLEQ- 204
Fly 205 -------NRLSHLH----------------KETFKDLQKLMHLS--------------------- 225
Fly 226 ----------------------------------------------------------------- 225
Fly 226 ----------------------------------LQGNAWNCSCELQDFRDFAISKRLY-----T 251
Fly 252 PPTDCQEPPQLRGKLWSEVPS----ENFAC-RPRILGSVRS--FIEANHDNISLPCRIVGSPRPN 309
Fly 310 VTWVYNKRPLQQYDPRVRVLTS-----VEQMPEQPSQVLTSELRIVGVRASDKGAYTCVADNRGG 369
Fly 370 369 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek5 | NP_001245746.1 | LRR_RI | <76..160 | CDD:238064 | 25/83 (30%) |
leucine-rich repeat | 76..100 | CDD:275380 | 7/23 (30%) | ||
LRR_8 | 99..159 | CDD:290566 | 18/59 (31%) | ||
leucine-rich repeat | 101..124 | CDD:275380 | 5/22 (23%) | ||
LRR | 122..145 | CDD:197688 | 8/22 (36%) | ||
leucine-rich repeat | 125..148 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 148..207 | CDD:290566 | 16/66 (24%) | ||
leucine-rich repeat | 149..172 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 173..196 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 197..>229 | CDD:290566 | 14/175 (8%) | ||
leucine-rich repeat | 197..220 | CDD:275380 | 11/46 (24%) | ||
LRRCT | 229..277 | CDD:214507 | 12/56 (21%) | ||
Ig | 296..376 | CDD:143165 | 23/79 (29%) | ||
lingo1 | NP_001093719.1 | LRRNT | 27..61 | CDD:214470 | 6/33 (18%) |
LRR 1 | 58..79 | 7/22 (32%) | |||
leucine-rich repeat | 59..82 | CDD:275380 | 7/24 (29%) | ||
PLN00113 | 62..>381 | CDD:215061 | 55/325 (17%) | ||
LRR 2 | 82..103 | 3/20 (15%) | |||
leucine-rich repeat | 83..106 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 106..165 | CDD:338972 | 19/58 (33%) | ||
LRR 3 | 106..127 | 7/20 (35%) | |||
leucine-rich repeat | 107..130 | CDD:275380 | 9/22 (41%) | ||
LRR 4 | 130..151 | 6/20 (30%) | |||
leucine-rich repeat | 131..154 | CDD:275380 | 7/22 (32%) | ||
LRR 5 | 154..175 | 5/20 (25%) | |||
leucine-rich repeat | 155..178 | CDD:275380 | 6/22 (27%) | ||
LRR 6 | 178..199 | 4/20 (20%) | |||
leucine-rich repeat | 179..250 | CDD:275380 | 13/70 (19%) | ||
LRR 7 | 202..223 | 1/20 (5%) | |||
leucine-rich repeat | 203..226 | CDD:275380 | 3/22 (14%) | ||
LRR 8 | 250..271 | 0/20 (0%) | |||
leucine-rich repeat | 251..274 | CDD:275380 | 0/22 (0%) | ||
LRR 9 | 274..295 | 0/20 (0%) | |||
leucine-rich repeat | 275..298 | CDD:275380 | 0/22 (0%) | ||
LRR 10 | 298..319 | 0/20 (0%) | |||
leucine-rich repeat | 299..322 | CDD:275380 | 0/22 (0%) | ||
LRR 11 | 322..343 | 0/20 (0%) | |||
leucine-rich repeat | 323..343 | CDD:275380 | 0/19 (0%) | ||
Ig | 425..500 | CDD:386229 | 24/83 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 49 | 1.000 | Domainoid score | I11593 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |