DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek5 and lingo1

DIOPT Version :9

Sequence 1:NP_001245746.1 Gene:kek5 / 32930 FlyBaseID:FBgn0031016 Length:931 Species:Drosophila melanogaster
Sequence 2:NP_001093719.1 Gene:lingo1 / 100101739 XenbaseID:XB-GENE-921957 Length:606 Species:Xenopus tropicalis


Alignment Length:520 Identity:103/520 - (19%)
Similarity:163/520 - (31%) Gaps:195/520 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 MILLLLGVL--VVLMALPPPTAGTTDWMQSCGTC--HCQWNSGKKSADCKNKALTKIPQDMSNEM 75
            |||.|...|  ::|:.:....:|      |...|  .|..:...:|..|..|....:|:.:..:.
 Frog     1 MILQLPSCLCPILLIVVGSILSG------SASGCPQRCDCSPQDRSVLCHRKRYLDVPEGIPTDT 59

  Fly    76 QVLDFAHNQIPELRREEFLLAGLPNVHKIFLRNCTIQEVHREAFKGLHILIELDLSGNRIRELHP 140
            ::||.:.|:|..|.::||  :..|.:.::.|....:..:...||.||..|..|.|..||::.:..
 Frog    60 RLLDLSKNRIKALNQDEF--SAFPYLEELELNENIVSIIEPGAFNGLFNLRSLGLRSNRLKLIPL 122

  Fly   141 GTFAGLEKLRNVIINNNEIEVLPNHLFVNLSFLSRIEFRNNRLRQVQLHVFAGTMALSAISLEQ- 204
            |.|.||..|..:.|:.|:|.:|.:.:|.:|..|..:|..:|.|..:....|.|..:|..::||: 
 Frog   123 GVFTGLSNLTQLDISENKIVILLDDMFQDLYNLKSLEVGDNDLVYISHRAFRGLNSLEELTLEKC 187

  Fly   205 -------NRLSHLH----------------KETFKDLQKLMHLS--------------------- 225
                   ..|||||                ..:||.|.:|.:|.                     
 Frog   188 NLTSVPTEALSHLHGLITLKLRYLNINVIRDYSFKRLYRLKNLEIAHWPYLDTMTSNGLYGLNLT 252

  Fly   226 ----------------------------------------------------------------- 225
                                                                             
 Frog   253 SLSITHSNLSSIPYVAIRHLVYLRFLNLSYNPITAVEGSMLYELLRLQEFHLVGGQLSVVEPYAF 317

  Fly   226 ----------------------------------LQGNAWNCSCELQDFRDFAISKRLY-----T 251
                                              |..|...|.|.|     ..|.:|.:     .
 Frog   318 RGLNHLKVLNVSSNYLSTLEESSFHSVGNLETLILDKNPLACDCRL-----LWIFRRRWRLNFSR 377

  Fly   252 PPTDCQEPPQLRGKLWSEVPS----ENFAC-RPRILGSVRS--FIEANHDNISLPCRIVGSPRPN 309
            ....|..|..::||.:.:.|.    ..|.| |.||......  :::..| .:...||..|.|.|.
 Frog   378 QQPSCSSPEYVQGKEFKDFPDVLQPNYFTCRRARIQDHSAQVVYVDEGH-TVHFFCRADGDPPPT 441

  Fly   310 VTWVYNKRPLQQYDPRVRVLTS-----VEQMPEQPSQVLTSELRIVGVRASDKGAYTCVADNRGG 369
            :.|         ..||...:||     :...|:.     |.|:|...|:  |.|.|.|:|.|.||
 Frog   442 ILW---------QSPRKTFITSKSNGRLTVFPDG-----TLEVRYAQVQ--DNGTYHCIASNAGG 490

  Fly   370  369
             Frog   491  490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek5NP_001245746.1 LRR_RI <76..160 CDD:238064 25/83 (30%)
leucine-rich repeat 76..100 CDD:275380 7/23 (30%)
LRR_8 99..159 CDD:290566 18/59 (31%)
leucine-rich repeat 101..124 CDD:275380 5/22 (23%)
LRR 122..145 CDD:197688 8/22 (36%)
leucine-rich repeat 125..148 CDD:275380 9/22 (41%)
LRR_8 148..207 CDD:290566 16/66 (24%)
leucine-rich repeat 149..172 CDD:275380 7/22 (32%)
leucine-rich repeat 173..196 CDD:275380 6/22 (27%)
LRR_8 197..>229 CDD:290566 14/175 (8%)
leucine-rich repeat 197..220 CDD:275380 11/46 (24%)
LRRCT 229..277 CDD:214507 12/56 (21%)
Ig 296..376 CDD:143165 23/79 (29%)
lingo1NP_001093719.1 LRRNT 27..61 CDD:214470 6/33 (18%)
LRR 1 58..79 7/22 (32%)
leucine-rich repeat 59..82 CDD:275380 7/24 (29%)
PLN00113 62..>381 CDD:215061 55/325 (17%)
LRR 2 82..103 3/20 (15%)
leucine-rich repeat 83..106 CDD:275380 5/22 (23%)
LRR_8 106..165 CDD:338972 19/58 (33%)
LRR 3 106..127 7/20 (35%)
leucine-rich repeat 107..130 CDD:275380 9/22 (41%)
LRR 4 130..151 6/20 (30%)
leucine-rich repeat 131..154 CDD:275380 7/22 (32%)
LRR 5 154..175 5/20 (25%)
leucine-rich repeat 155..178 CDD:275380 6/22 (27%)
LRR 6 178..199 4/20 (20%)
leucine-rich repeat 179..250 CDD:275380 13/70 (19%)
LRR 7 202..223 1/20 (5%)
leucine-rich repeat 203..226 CDD:275380 3/22 (14%)
LRR 8 250..271 0/20 (0%)
leucine-rich repeat 251..274 CDD:275380 0/22 (0%)
LRR 9 274..295 0/20 (0%)
leucine-rich repeat 275..298 CDD:275380 0/22 (0%)
LRR 10 298..319 0/20 (0%)
leucine-rich repeat 299..322 CDD:275380 0/22 (0%)
LRR 11 322..343 0/20 (0%)
leucine-rich repeat 323..343 CDD:275380 0/19 (0%)
Ig 425..500 CDD:386229 24/83 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11593
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.