| Sequence 1: | NP_001245746.1 | Gene: | kek5 / 32930 | FlyBaseID: | FBgn0031016 | Length: | 931 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001093704.1 | Gene: | dcn / 100101716 | XenbaseID: | XB-GENE-485545 | Length: | 364 | Species: | Xenopus tropicalis |
| Alignment Length: | 221 | Identity: | 53/221 - (23%) |
|---|---|---|---|
| Similarity: | 94/221 - (42%) | Gaps: | 30/221 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 32 PTAGTTDWMQSCGTCHCQWNSGKKSADCKNKALTKIPQDMSNEMQVLDFAHNQIPELRREEFLLA 96
Fly 97 GLPNVHKIFLRNCTIQEVHREAFKGLHILIELDLSGNRIRELHPGTFAGLEKLRNVIINNNEIEV 161
Fly 162 LPNHLFVNLSFLSRIEFRNNRLRQ--VQLHVFAGTMALS---------------------AISLE 203
Fly 204 QNRLSHLHKETFKDLQKLMHLSLQGN 229 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek5 | NP_001245746.1 | LRR_RI | <76..160 | CDD:238064 | 25/83 (30%) |
| leucine-rich repeat | 76..100 | CDD:275380 | 7/23 (30%) | ||
| LRR_8 | 99..159 | CDD:290566 | 18/59 (31%) | ||
| leucine-rich repeat | 101..124 | CDD:275380 | 7/22 (32%) | ||
| LRR | 122..145 | CDD:197688 | 7/22 (32%) | ||
| leucine-rich repeat | 125..148 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 148..207 | CDD:290566 | 16/81 (20%) | ||
| leucine-rich repeat | 149..172 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 173..196 | CDD:275380 | 5/24 (21%) | ||
| LRR_8 | 197..>229 | CDD:290566 | 8/52 (15%) | ||
| leucine-rich repeat | 197..220 | CDD:275380 | 5/43 (12%) | ||
| LRRCT | 229..277 | CDD:214507 | 1/1 (100%) | ||
| Ig | 296..376 | CDD:143165 | |||
| dcn | NP_001093704.1 | LRRNT | 58..90 | CDD:214470 | 6/33 (18%) |
| leucine-rich repeat | 67..87 | CDD:275380 | 4/19 (21%) | ||
| PRK15370 | <75..>303 | CDD:185268 | 46/191 (24%) | ||
| leucine-rich repeat | 88..111 | CDD:275380 | 7/24 (29%) | ||
| leucine-rich repeat | 112..135 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 136..156 | CDD:275380 | 6/19 (32%) | ||
| leucine-rich repeat | 157..180 | CDD:275380 | 8/25 (32%) | ||
| leucine-rich repeat | 181..206 | CDD:275380 | 5/24 (21%) | ||
| leucine-rich repeat | 207..227 | CDD:275380 | 2/19 (11%) | ||
| leucine-rich repeat | 228..251 | CDD:275380 | 3/22 (14%) | ||
| leucine-rich repeat | 252..275 | CDD:275380 | 4/9 (44%) | ||
| leucine-rich repeat | 299..320 | CDD:275380 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||