DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSD17B3 and spidey

DIOPT Version :9

Sequence 1:NP_000188.1 Gene:HSD17B3 / 3293 HGNCID:5212 Length:310 Species:Homo sapiens
Sequence 2:NP_572420.1 Gene:spidey / 31703 FlyBaseID:FBgn0029975 Length:321 Species:Drosophila melanogaster


Alignment Length:245 Identity:109/245 - (44%)
Similarity:157/245 - (64%) Gaps:11/245 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    40 PKSF-----LRSMGQWAVITGAGDGIGKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRS 99
            ||.|     |..||:|||:||:.|||||||:.|||:|||.:|||||:||||..:|.||....|..
  Fly    39 PKVFGSSVDLSKMGEWAVVTGSTDGIGKAYAKELARRGLKLVLISRSLEKLNVVAKEIGDKYGVE 103

Human   100 VKIIQADFT-KDDIYEHIKEKLAGLEIGILVNNVGMLPNLLPSHFLNA----PDEIQSLIHCNIT 159
            |::|..||| .|:||:.|:||..||.:|:||||||:... .|.:||:.    |..:::::..||.
  Fly   104 VRVIDVDFTGGDEIYDKIREKTTGLNVGVLVNNVGISYG-HPEYFLDCYKADPPFLRNIVAANIH 167

Human   160 SVVKMTQLILKHMESRQKGLILNISSGIALFPWPLYSMYSASKAFVCAFSKALQEEYKAKEVIIQ 224
            ||..||.|.|..|.|:::|:|:|:||...:.|.||.|:||::||||..||..||.|||...::||
  Fly   168 SVTHMTALFLPGMISQRRGVIINVSSTAGVIPNPLLSVYSSTKAFVNKFSDDLQTEYKEHGILIQ 232

Human   225 VLTPYAVSTAMTKYLNTNVITKTADEFVKESLNYVTIGGETCGCLAHEIL 274
            .:.|..|:|.|:|....:|...:.:.:|:.:|:.:.|..:|.|.|.|.:|
  Fly   233 SVQPGFVATNMSKIRKASVFAPSPETYVRSALSTLGIATQTAGYLPHALL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSD17B3NP_000188.1 17beta-HSD1_like_SDR_c 48..284 CDD:187614 104/232 (45%)
spideyNP_572420.1 PLN02780 8..321 CDD:166421 109/245 (44%)
17beta-HSD1_like_SDR_c 52..288 CDD:187614 104/232 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0300
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D584062at33208
OrthoFinder 1 1.000 - - FOG0000465
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43899
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R721
SonicParanoid 1 1.000 - - X484
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.950

Return to query results.
Submit another query.