DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment out and MCH5

DIOPT Version :9

Sequence 1:NP_001285435.1 Gene:out / 32926 FlyBaseID:FBgn0259834 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_014951.4 Gene:MCH5 / 854483 SGDID:S000005833 Length:521 Species:Saccharomyces cerevisiae


Alignment Length:179 Identity:46/179 - (25%)
Similarity:81/179 - (45%) Gaps:13/179 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NDTTKPKKPKRRDKSDLGPDFVAPDGGW-GWVVCLAAGLNNFFLFPALQQYGLIYRVRMQSLGFD 79
            |.::.....|..|.::....|  |:||: .|||.....|.....|..|...|:| ...:|.....
Yeast    79 NTSSTHDSDKEEDSNEEIESF--PEGGFKAWVVTFGCFLGLIACFGLLNSTGVI-ESHLQDNQLS 140

  Fly    80 AKQTTTI---VNVVMAISSLVGIVNGAMFRRFTFRQVALTGTSLAFLGVFLSAFCTTFWQYIICL 141
            ::..:||   .::.:.:.|...|::|..|.|..||.:.:.||.....|:|.:|..|.:|.:|:..
Yeast   141 SESVSTIGWLFSLFLFVCSASCIISGTYFDRNGFRTIMIVGTVFHVAGLFATANSTKYWHFILSF 205

  Fly   142 SAIFGIGLGLAMA-ATSLAVNTYFKLKRRRATGFSWTITG--LGPIFFP 187
            :.:.|.|.|:.:: ..|:..:.:||   ||.|..:....|  :|.:.||
Yeast   206 AIVCGFGNGIVLSPLVSVPAHYFFK---RRGTALAMATIGGSVGGVVFP 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
outNP_001285435.1 MFS 45..>225 CDD:119392 39/149 (26%)
MFS <464..621 CDD:119392
MFS_1 468..>621 CDD:284993
MCH5NP_014951.4 MFS_MCT_SLC16 106..510 CDD:340910 39/150 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343221
Domainoid 1 1.000 56 1.000 Domainoid score I2686
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11360
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.800

Return to query results.
Submit another query.