DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment out and Slc16a13

DIOPT Version :9

Sequence 1:NP_001285435.1 Gene:out / 32926 FlyBaseID:FBgn0259834 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_758959.1 Gene:Slc16a13 / 69309 MGIID:1916559 Length:428 Species:Mus musculus


Alignment Length:185 Identity:47/185 - (25%)
Similarity:92/185 - (49%) Gaps:0/185 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PDGGWGWVVCLAAGLNNFFLFPALQQYGLIYRVRMQSLGFDAKQTTTIVNVVMAISSLVGIVNGA 103
            |||||||:|.|:|...:..:|..|:.:|:.:...:.:....|.:.:.|.::.:|:......:..|
Mouse     8 PDGGWGWMVVLSAFFQSALVFGVLRSFGVFFVEFVAAFEEQAARVSWIASIGIAVQQFGSPIGSA 72

  Fly   104 MFRRFTFRQVALTGTSLAFLGVFLSAFCTTFWQYIICLSAIFGIGLGLAMAATSLAVNTYFKLKR 168
            :..:...|.|.:||..||.||:.|::|.|:.....:.:..:.|.|..|....|...::.||..:|
Mouse    73 LSTKLGPRPVVMTGGILAALGMLLASFATSLTHLYLSIGLLSGSGWALTFTPTMACLSRYFSQRR 137

  Fly   169 RRATGFSWTITGLGPIFFPQVSTVLLGYYGAQGTILIYAGIAMNAILCALTLQPV 223
            ..|.|.:.|..|:....|..:...|:..|..:|.:|:.:.::::.:.|...|:|:
Mouse   138 SLAMGLALTGVGISSFAFAPLFQWLINNYAWRGALLLVSALSLHLMACGALLRPL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
outNP_001285435.1 MFS 45..>225 CDD:119392 41/179 (23%)
MFS <464..621 CDD:119392
MFS_1 468..>621 CDD:284993
Slc16a13NP_758959.1 MFS 14..392 CDD:119392 41/179 (23%)
2A0111 14..383 CDD:273323 41/179 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835590
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X70
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.